Recombinant Mouse Diacylglycerol kinase epsilon (Dgke)

Code: CSB-CF865640MO
Size:
20μg
20μg100μg
US$6715
Quantity:
Express system: in vitro E.coli expression system
Species: Mus musculus (Mouse)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
Dgke
Uniprot NO.
Alternative Names
Dgke; Diacylglycerol kinase epsilon; DAG kinase epsilon; Diglyceride kinase epsilon; DGK-epsilon
Species
Mus musculus (Mouse)
Source
in vitro E.coli expression system
Expression Region
1-564
Target Protein Sequence
MEGDQRSGPPAQSLLPDGHLVLWTLCSVLLPVFITLWCSLQRSRRQLHRRDIFRKSKHCW RDTDLFSHPTYCCVCAQHILQGAFCDCCGLRVDEGCLKKVDKRFPCKEIMLKNDKAADAM PHHWIRGNVPLCSYCVFCRQQCGSQPKLCDYRCIWCQKTVHDECMRGSLRSEKCDFGEFR NLIIPPSYLTSINQMRKDKNTNYEGLASKFGKQWTPLIILANSRSGTNMGEGLLGEFKIL LNPVQVFDVTKTPPIKALQLCTLLPYYSVRVLVCGGDGTVGWVLDAIDEMKIKGQEKYIP EVAVLPLGTGNDLSNTLGWGTGYAGEIPVAQVLRNVMEADGIKLDRWKVQVTNKGYYNLR KPKEFTMNNYFSVGPDALMALNFHAHREKAPSLFSSRILNKAVYLFYGTKDCLVQECKDL NKKIELELDGERVELPNLEGIIVLNIGYWGGGCRLWEGMGDETYPLARHDDGLLEIVGVY GSFHCAQIQVKLANPFRIGQAHTVRLTLKCSMMPMQVDGEPWAQGPCTVTITHKTHALML YFSGEQSDDDISSPSDHEDVKEAE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Membrane-bound diacylglycerol kinase that converts diacylglycerol/DAG into phosphatidic acid/phosphatidate/PA and regulates the respective levels of these two bioactive lipids. Thereby, acts as a central switch between the signaling pathways activated by these second messengers with different cellular targets and opposite effects in numerous biological processes. Also plays an important role in the biosynthesis of complex lipids. Displays specificity for diacylglycerol substrates with an arachidonoyl acyl chain at the sn-2 position, with the highest activity toward 1-octadecanoyl-2-(5Z,8Z,11Z,14Z-eicosatetraenoyl)-sn-glycerol the main diacylglycerol intermediate within the phosphatidylinositol turnover cycle. Can also phosphorylate diacylglycerol substrates with a linoleoyl acyl chain at the sn-2 position but much less efficiently.
Gene References into Functions
  1. DGKepsilon plays a role in glucose and energy homeostasis by modulating lipid metabolism in skeletal muscle PMID:28246337
  2. Our results unveil an unexpected role of Dgke in the induction of cyclooxygenase-2 and in the regulation of glomerular prostanoids synthesis under stress PMID:26887830
  3. Inhibition of lipid signaling enzyme diacylglycerol kinase epsilon attenuates mutant huntingtin toxicity. PMID:22511757
  4. A regulatory role is suggested for DGK epsilon, COX-2, and catecholamine signaling during kindling epileptogenesis. PMID:16137646
  5. DGKepsilon plays a significant role in determining the enrichment of GPInsP n with 20:4 and that there is a pathway for the selective translocation of arachidonoyl phosphatidic acid from the plasma membrane to the endoplasmic reticulum PMID:18702510

Show More

Hide All

Subcellular Location
Membrane; Single-pass membrane protein. Cytoplasm.
Protein Families
Eukaryotic diacylglycerol kinase family
Tissue Specificity
Highly expressed in brain and heart. In brain, highly expressed in Purkinje cells of the cerebellum, pyramidal cells of the hippocampus, mitral cells of the olfactory bulb, and neurons of the substantia nigra. Lower expression in neurons of the thalamus,
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products