MGNSSATEDGGLLAGRGPESLGTGAGLGGAGAAALVGGVLLIGLVLAGNSLVCVSVASER TLQTPTNYFIVSLAAADLLLAVLVLPLFVYSEVQGGVWLLSPRLCDTLMAMDVMLCTASI FNLCAISVDRFVAVTVPLRYNQQGQCQLLLIAATWLLSAAVASPVVCGLNDVPGRDPAVC CLENRDYVVYSSVCSFFLPCPLMLLLYWATFRGLRRWEAARHTKLHSRAPRRPSGPGPPV SDPTQGPFFPDCPPPLPSLRTSPSDSSRPESELSQRPCSPGCLLADAALPQPPEPSSRRR RGAKITGRERKAMRVLPVVVGAFLVCWTPFFVVHITRALCPACFVSPRLVSAVTWLGYVN SALNPIIYTIFNAEFRSVFRKTLRLRC
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Dopamine receptor responsible for neuronal signaling in the mesolimbic system of the brain, an area of the brain that regulates emotion and complex behavior. Activated by dopamine, but also by epinephrine and norepinephrine, and by numerous synthetic agonists and drugs. Agonist binding triggers signaling via G proteins that inhibit adenylyl cyclase. Modulates the circadian rhythm of contrast sensitivity by regulating the rhythmic expression of NPAS2 in the retinal ganglion cells.
Gene References into Functions
data imply that enhanced D4 receptor-mediated dopaminergic control of corticostriatal transmission constitutes a vulnerability factor of ADHD and other neuropsychiatric disorders.PMID:28097219
Results indicate that the full rescue of impaired LTP in aging is achieved by the selective D4R activation.PMID:28975698
over-suppression of NMDAR function may underlie the role of hD4.7 in attention deficit hyperactivity disorderPMID:27475724
The G-protein coupled receptor, DRD4, requires ARR1 and ARR4 for desensitization and internalization.PMID:26169958
This study demonstrated that dopamine D4 receptor gene has an important role in increased exploratory and anxiolytic behavior only in males and these behaviors were positively correlated with increased alcohol consumption.PMID:25914336
Contrast sensitivity is reduced in Drd4-/- mice.PMID:24048828
dopaminergic modulation of early long-term potentiation in stratum oriens occurs through NMDA receptors containing NR2B subunits via D4RsPMID:21955919
Data demonstrate that stimulating the dopamine Dreceptor is essential in maintaining the normal rhythmic production of adenylyl cyclase 1 from transcript to enzyme activity.PMID:21676039
This study demonistrated that the dopamine D4 receptor is the role of attention.PMID:21458500
The result of this study demonistrated that the dopamine drd4 receptor appears to be important for specific exploration.PMID:21412225
Data suggest that dopamine D4 receptors modulate not only the prefrontal cortex, but also the cerebellar vermis, which may reflect an indirect modulation as D4Rs are minimally expressed in this region.PMID:20646063
no connection between analysed polymorphism of genes: DRD2, DRD3, DRD4, DAT, COMT and schizophrenia was stated.PMID:20672519
This result suggests an effect of 5-HTTLPR on externalizing behavior in the presence of DRD4 7r but no effect in its absence.PMID:19696961
absence of D4Rs increases avoidance behaviour to unconditioned stimuli and does not impair behavioural reactions to Pavlovian fear-conditioningPMID:11860516
Postsynaptic activation of dopamine D4 receptors reduces GABAergic currents in globus pallidus neurons.PMID:14684868
D4R signaling is essential for the expression of juvenile hyperactivity and impaired behavioral inhibition, relevant features present in this attention deficit disorder-like mouse model.PMID:14699433
The findings suggest that D1, D4, and NMDA receptors may interact functionally and that developmental absence of D4 receptors might trigger compensatory mechanisms that enhance expression of D1 receptorsPMID:14997010
D4 dopamine receptor is found to be expressed in the subcommissural organ (SCO), an ependymal brain gland that is located in the roof of the third ventricle.PMID:15197646
Absence of dopamine D4 receptor increases blood pressure, possibly via increased angiotensin II type 1 receptor expression.PMID:16380537
KLHL12 specifically interacts with the D4 polymorphism, thereby building up a Cul3-E3 ligase complex with substrate specificity toward the D4 receptorPMID:18303015
absence of D4R is not sufficient to cause psychopathologies associated with heightened impulsivity and novelty seekingPMID:18456309
data indicate that the DRD4 receptor is involved in modulation of glutamate neurotransmission, primarily in the striatumPMID:18536704
Drd4 activation is required for normal expression of adenylyl cyclase type 1 and for regulation of its catalytic activity by light.PMID:19166506
D(4) dopamine receptor differentially regulates Akt/nuclear factor-kappaB and extracellular signal-regulated kinase pathways in D(4)MN9D cells.PMID:11562449
Show
More
Hide
All
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Detected in olfactory bulb, hypothalamus, olfactory tubercle, brainstem and striatum.