MLPPGRNGTAHRARLGLQRQLAQVDAPGGSAAPLGPAQVVTAGLLTLLIVWTLLGNVLVC AAIVRSRHLRAKMTNIFIVSLAVSDLFVALLVMPWKAVAEVAGYWPFGAFCDIWVAFDIM CSTASILNLCIISVDRYWAISRPFRYERKMTQRVALVMVALAWTLSILISFIPVQLNWHR DKAGSQGREGLLSNETPWEEGWELDGRTENCDSSLNRTYAISSSLISFYIPVAIMIVTYT RIYRIAQVQIRRISSLERAAEHAQSCRSRGACEPDPSLRASIKKETKVFKTLSVIMGVFV CCWLPFFILNCMVPFCSSGDAQGPRTGFPCVSETTFDIFVWFGWANSSLNPIIYAFNADF RKVFAQLLGCSHLCFRTPVQTVNISNELISYNQDTVFHREIAAAYVHMIPNAVSSGDREV GEEEEAEEEGPFDHMSQISPTTPDGDLAAESVWELDCEEEVSLGKISPLTPNCFHKTA
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Dopamine receptor whose activity is mediated by G proteins which activate adenylyl cyclase.
Gene References into Functions
n T2 mice, the mRNA expression of Retn showed a moderate up-regulation (fold change=8.32; p=0.0019) in the adipose tissues. Iapp expression was also significantly up-regulated (fold change=9.78; p=0.012). Moreover, a 6.36-fold up-regulation for Drd5 was observed in the adipose tissues of T2 micePMID:29936463
Findings demonstrate the relevant contribution of dopamine receptor D5 (D5R) in memory and suggest a functional interaction of D5R with hippocampal glutamatergic pathways.PMID:26714288
We suggest that the ability of the dopamine D5 receptor to negatively regulate the renal NADPH oxidase activity and AT1R function may have important implications in the pathogenesis of salt-sensitive blood pressure.PMID:25716648
This study demonstrated that D5R stimulation contributes to an efficient CD4(+)T-cell-induced early ERK1/2 phosphorylation, and differentiation.PMID:26025054
The dopamine D5 receptors are particularly important in regulating plasticity of the medial perforant path onto the dentate granule cells.PMID:25429131
This study demonistrated that the dopamine D5 receptor as a regulator of BDNF and Akt signalling in rodent prefrontal cortex.PMID:22827965
SNX1 has a crucial role in D(5)R trafficking and SNX1 depletion results in D(5)R dysfunction and thus may represent a novel mechanism for the pathogenesis of essential hypertensionPMID:23152498
By contributing to CD4(+) T cell activation and differentiation to Th17 phenotype, D5R expressed on DCs is able to modulate the development of an autoimmune response in vivo.PMID:22379034
We propose that ciliary DR5 has functional chemo- and mechano-sensory roles in endothelial cells.PMID:21709211
There is a role of renal D(5) receptors in blood pressure homeostasis and the pathogenesis of hypertension in mice.PMID:21051739
Mice lacking D5 dopamine receptors have increased sympathetic tone and are hypertensive.PMID:12486173
Dopamine D5 receptor knockout mice were used to study the role of D5 dopamine receptors in the locomotor-discriminative effects of cocaine.PMID:12768268
these results confirm and extend the role of the d5 receptor in the modulation of hippocampal acetylcholine release and provide evidence for long-term alteration of hippocampal cholinergic neurotransmissionPMID:15100705
D5 dopamine receptor is found to be expressed in the subcommissural organ (SCO), an ependymal brain gland that is located in the roof of the third ventricle.PMID:15197646
Dopamine D5 receptor regulates phospholipase D2(PLD2) activity and expression. Hypertension in D5(-/-) mice is associated with increased PLD expression and activity. Impaired D5 receptor regulation of PLD2 may play role in pathogenesis of hypertension.PMID:15598876
The D(5) receptor mediates discrete topographies of behaviour relating to exploration, and sequential motor coordination; these processes change over the course of interaction with and habituation to the environment.PMID:15668951
The ability of D5 receptor stimulation to decrease ROS production may explain, in part, the antihypertensive action of D5 receptor activation.PMID:16352863
the expression and extensive postsynaptic distribution of all known dopamine receptors in spinal cord correspond well with the broad descending dopaminergic projection territory .PMID:17936519
Dopamine 5 receptor mediates Ang II type 1 receptor degradation via a ubiquitin-proteasome pathway in mice and human cellsPMID:18464932
This review discusses dopamine D5 receptors, which are required for dopamine and selective D(1)-like agonists to induce phospholipase C-mediated phosphoinositide signaling in the mammalian brain.PMID:19047479
The mRNA level of alpha/beta hydrolase 1 (ABHD1) is significantly upregulated in D5-/- mice.PMID:19073140
Endogenous dopamine D1/D5 receptor activation decreases NR2A/NR2B ratio of N-methyl-D-aspartate (NMDA) receptor subunit composition at glutamatergic synapses.PMID:19279248