Ctla4; Cd152; Cytotoxic T-lymphocyte protein 4; Cytotoxic T-lymphocyte-associated antigen 4; CTLA-4; CD antigen CD152
Species
Mus musculus (Mouse)
Source
in vitro E.coli expression system
Expression Region
36-223
Target Protein Sequence
EAIQVTQPSVVLASSHGVASFPCEYSPSHNTDEVRVTVLRQTNDQMTEVCATTFTEKNTVGFLDYPFCSGTFNESRVNLTIQGLRAVDTGLYLCKVELMYPPPYFVGMGNGTQIYVIDPEPCPDSDFLLWILVAVSLGLFFYSFLVSAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
10xHis-SUMO-tag
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Inhibitory receptor acting as a major negative regulator of T-cell responses. The affinity of CTLA4 for its natural B7 family ligands, CD80 and CD86, is considerably stronger than the affinity of their cognate stimulatory coreceptor CD28.
Gene References into Functions
Immunogenic mouse neuroblastoma acquires adaptive immune resistance by up-regulating PD-L1 expression, whereas PD-L1 is of lesser consequence in nonimmunogenic neuroblastoma tumors. Combining PD-L1 checkpoint inhibition with whole tumor cell/anti-CTLA-4 vaccination enhanced tumor cell killing, cured mice with established tumors, and induced long-term immune memory (6 months).PMID:29377881
the investigation of RANK and RANKL as possible novel immunotherapy targets in cancer is a rational approach. Here we have defined the mechanism of action of RANKL-RANK blockade in combination with anti-CTLA4, and provide insight into the combination efficacy observed in the case reports.PMID:28634284
reveal a novel CTLA-4-mediated pathway to attenuate cytotoxic T-lymphocytes and indicate the importance of post-transcriptional mechanisms in the regulation of anti-tumor immune responsesPMID:28644433
The potential of the CTLA4 and G250 co-expression DNA vaccine.PMID:28351777
Tregs were observed to regulate CD4(+), but not CD8(+), T cell infiltration into tumors through a CTLA-4/CD80 dependent mechanism. Disrupting CTLA-4 interaction with CD80 was sufficient to induce CD4 T cell infiltration into tumors.PMID:28856392
These results suggest that CD44(+)CD117(+) T cells are stem cells and a specific T-cell phenotype that initially develops in the thymus, but they do not progress through DN3 and DN4 stages, lack a DP stage, and potently suppress T-cell proliferation and modulate the CTLA-4 pathway.PMID:28279199
data suggest that increased expression of checkpoint blockade molecules PD-1 and CTLA-4 on donor T cells is not sufficient to prevent GvHD, and that cooperation between checkpoint blockade signaling by host cells and donor Tregs is necessary to limit GvHD in allo-HSCT recipientsPMID:28953925
Treg cells expand in both humans and mice in blood-stage malaria and interfere with conventional T helper cell responses and follicular T helper (TFH)-B cell interactions in germinal centers. Mechanistically, Treg cells function in a critical temporal window to impede protective immunity through cytotoxic-T-lymphocyte-associated protein-4 (CTLA-4).PMID:28892065
CTLA-4 expressed by FOXP3(+) regulatory T cells prevents inflammatory tissue attack and not T-cell priming in arthritis.PMID:28497863
results are consistent with a complex pathway in which CD28 is the primary driver of Treg proliferation and CTLA-4 functions as the main brake but is also dependent on TCR signals and interactions with CD80/CD86PMID:28053234
CTLA-4(+) microvesicles can competitively bind B7 costimulatory molecules on bystander dendritic cells, resulting in downregulation of B7 surface expression.PMID:26979751
this study shows that miR-155 is modulated by a major dust mite allergen, Dermatophagoides farinae (Df1), and increases CD4+ T cell proliferation through the downregulation of cytotoxic T lymphocyte-associated antigen 4 (CTLA-4) expressionPMID:28110885
CTLA-4 regulates atherosclerosis by suppressing proatherogenic immune responses.PMID:27055906
Data suggest enhanced clinical benefit from combining CTLA-4 antigen blockade with poxvirus-based active immunotherapy.PMID:26961085
up-regulated expression correlates with the tolerogenic effect of syngeneic hematopoietic stem cell transplantationPMID:26311302
Induced Treg Cells Augment the Th17-Mediated Intestinal Inflammatory Response in a CTLA4-Dependent MannerPMID:26950218
CTLA-4 has a regulatory T cell-intrinsic role in limiting peripheral regulatory T cell expansion and activation, and in their capacity to control conventional T cells.PMID:26371185
The Ctla4 SNP (e2_77A/G) does not alter diabetes susceptibility, but does control mRNA alternative splicing.PMID:26450994
Sorafenib suppressed the expression of immunosuppressive factors in MDSCs. These data indicate that combination therapy of sorafenib and anti-CTLA-4 Ab may be effective in advanced kidney cancer patients.PMID:25845968
The co-stimulatory molecule CTLA-4 mediates in vitro differentiation of iTreg cells.PMID:25238105
The bullseye immunological synapse formation is mediated by CTLA4, and may negatively control T-cell activation as a suppressive synapse.PMID:25287444
this study reports that regulatory T (Treg) cells orchestrate memory T cell quiescence by suppressing effector and proliferation programs through inhibitory receptor, cytotoxic- T-lymphocyte-associated protein-4 (CTLA-4).PMID:26084026
Short-term blockade with anti-CTLA-4 antibody in wild-type mice is sufficient to elicit follicular helper T cell generation and germinal center development. The latter occurs in a CD28-dependent manner.PMID:25548162
CTLA-4 and mTOR down-regulation cooperate during CD8+ T cell priming to promote memory formation and metabolic readiness.PMID:25624453
role in Treg cell-mediated control of T follicular regulatory cell proliferation, germinal center formation,and of humoral immune responsesPMID:25526312
The study concludes that although the presence of CTLA4 plays a critical role in controlling homeostasis of T cells, its quantitative variation may impose diverse or even opposing effects on distinct lineages of T cells, an optimal sum of which is necessary for preservation of T cell immunity while suppressing tissue damage.PMID:25246499
cardiomyocytes can express CD80; this expression pattern can resist CTL-mediated lysis through CTLA-4 pathwayPMID:24507064
Alternative splice forms of CTLA-4 induced by antisense mediated splice-switching influences autoimmune diabetes susceptibility in NOD mice.PMID:24494586
CTLA4(apt) fused to a STAT3-targeting siRNA (CTLA4(apt)-STAT3 siRNA) resulted in internalization into tumor-associated CD8 T cells and silencing of STAT3, which activated tumor antigen-specific T cells in tumor models.PMID:24892807
results show that CTLA-4 promotes Tc17 differentiation that results in robust Tc17 responsesPMID:24723371
These data suggest that effects associated with and mediated through Tyr201 of CTLA-4s intracellular domain are critical for Treg-cell function.PMID:24648182
Our in vitro experiments revealed that IL-2 induced expression of CTLA-4 in mouse natural killer cellsPMID:24688023
These novel insights into the differential regulation of CTLA-4 coinhibition on CD4(+) T cells have implications for the immunomodulation of pathologic T cell responses during transplantation and autoimmunity.PMID:24493820
SOCS3 interacts with CTLA-4 and negatively regulates CTLA-4 levels in T cells, providing a mechanistic explanation for the expansion of regulatory T cells in CD4-SOCS3 during experimental autoimmune uveitis.PMID:24101549
This novel mechanism of CTLA-4lg immunotherapy may lead to an ideal anti-obesity/inflammation/insulin resistance agent.PMID:23872146
Data show coexpression of PD-1 and CTLA-4 correlates with more severe dysfunction of tumor-specific CD8+ T cells.PMID:23633484
Our results identify CTLA-4 as a key factor that regulates the composition of the Foxp3+ T-cell population in the intestine.PMID:22910217
The soluble isoform of CTLA-4 is a regulator of T-cell responses.PMID:23400950
The presence of the alternatively spliced 1/4 CTLA-4 isoform can further promote autoimmunity and autoimmune pathology in lupus-prone mice and suggests that altered splicing of CTLA4 contributes to the expression of autoimmune disease.PMID:23203389
Li-CTLA-4 expressed at physiologic levels in the CTLA-4-sufficient NOD background suppresses autoimmunity; but, the functionality of the li-CTLA-4 isoform depends on the presence of the full-length molecule to alter effector T cell signaling.PMID:23293354
CTLA-4 is expressed in the corticomedullary region of the thymus. Its absence alters the response of CD4(+)CD8(-) thymocytes to self-antigen recognition, which affects the quantity of the Treg cells and broadens the repertoire of peripheral T cells.PMID:23267099
pathways by which cAMP regulates CTLA4 expression, focusing on transcriptional activationPMID:23024062
Findings indicate that CTLA-4-negative regulation of conventional T cells (Tconvs) but not regulatory T cells (Tregs) in immune responses.PMID:23047820
direct evidence that CTLA4 inhibits spontaneous tumor developmentPMID:22777737
CTLA-4 on normal effector CD4-positive T cells completely abrogates the dramatically increased expansion normally experienced by their CTLA-4-deficient counterparts.PMID:22753941
a potential new role for CTLA-4 in Treg differentiationPMID:22337882
the importance of intracellular localization for CTLA-4 protein function and reveal that CTLA-4 protein externalization imparts suppressor function to both regulatory and conventional CD4(+) T cells.PMID:22403258
boosting CD152 or its down-stream signal transduction could aid therapies aimed at sensitizing T lymphocytes for optimal migration, thus contributing to a precise and effective immune response.PMID:22412835
The expression of CTLA-4 and PD-1 on T cells correlates with the extent of proinflammatory responses induced during Plasmodium berghei infection, being higher in C57BL/6 than in BALB/c mice.PMID:22319445
CTLA4-Ig may promote neuronal differentiation during the treatment of neurological diseases with cell replacement therapyPMID:22155494
Show
More
Hide
All
Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Tissue Specificity
Widely expressed with highest levels in lymphoid tissues.