Recombinant Mouse Cytokine receptor common subunit gamma (Il2rg)

Code: CSB-CF011651MO
Size:
20μg
20μg100μg
US$5091
Quantity:
Express system: in vitro E.coli expression system
Species: Mus musculus (Mouse)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
Il2rg
Uniprot NO.
Alternative Names
Il2rg; Cytokine receptor common subunit gamma; Interleukin-2 receptor subunit gamma; IL-2 receptor subunit gamma; IL-2R subunit gamma; IL-2RG; gammaC; p64; CD antigen CD132
Species
Mus musculus (Mouse)
Source
in vitro E.coli expression system
Expression Region
23-369
Target Protein Sequence
WSSKVLMSSANEDIKADLILTSTAPEHLSAPTLPLPEVQCFVFNIEYMNCTWNSSSEPQATNLTLHYRYKVSDNNTFQECSHYLFSKEITSGCQIQKEDIQLYQTFVVQLQDPQKPQRRAVQKLNLQNLVIPRAPENLTLSNLSESQLELRWKSRHIKERCLQYLVQYRSNRDRSWTELIVNHEPRFSLPSVDELKRYTFRVRSRYNPICGSSQQWSKWSQPVHWGSHTVEENPSLFALEAVLIPVGTMGLIITLIFVYCWLERMPPIPPIKNLEDLVTEYQGNFSAWSGVSKGLTESLQPDYSERFCHVSEIPPKGGALGEGPGGSPCSLHSPYWPPPCYSLKPEA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Common subunit for the receptors for a variety of interleukins. Probably in association with IL15RA, involved in the stimulation of neutrophil phagocytosis by IL15.
Gene References into Functions
  1. Suggest that soluble common gamma chain may be one of the target molecules for the control of immunopathogenic progresses in COPD. PMID:28331303
  2. degree to which immune rejection contributes to these disappointing outcomes using an immunodeficient IL2 receptor gamma (IL2rgamma)-null mouse model, was examined. PMID:28089909
  3. We have confirmed the activation of human peripheral blood lymphocytes after being xenografted in immunodeficient Rag2-/-IL2Rgnull mice. PMID:26113085
  4. Results demonstrate that IL2Rgamma has an onogenic role in JAK3-mutation-positive leukemias. PMID:25109334
  5. findings demonstrate that NOD SCID IL2R common gamma chain -/- mice are capable of engraftment of canine PBLs yet develop graft versus host disease similar to Hu-PBL-SCID mice PMID:24368085
  6. Human colon cancer xenografts propagated in NSG and NRG mice maintain structural fidelity while replacing human stromal cells with murine stromal cells. PMID:24798995
  7. The potential for dysregulated T cell and dendritic cell (DC) activation in the gamma(c)-deficient environment leading to allergic lung inflammation. PMID:23940740
  8. gammac expression was required to signal the differentiation of MHC class I-specific thymocytes into CD8+ cytotoxic lineage T cells and into invariant natural killer T cells. PMID:23109710
  9. critical for intestinal T-cell reconstitution in humanized mice PMID:22569301
  10. analysis of multiorgan metastasis of human HER-2+ breast cancer in Rag2-/-;Il2rg-/- mice and treatment with PI3K inhibitor PMID:22737248
  11. Results indicated that the extracellular and transmembrane domains of gammaC and IL-13Ralpha1 controlled the magnitude of the intracellular signaling response to IL-4 and IL-13. PMID:22829596
  12. physiologic impact of CB hematopoietic progenitor cell hypofucosylation was investigated in vivo in NOD-SCID interleukin (IL)-2Rgamma(null) (NSG) mice PMID:22306295
  13. Letter: Hyperglycemia-induced proliferation of adult human beta cells engrafted into spontaneously diabetic immunodeficient NOD-Rag1null IL2rgammanull Ins2Akita mice. PMID:21926555
  14. CD34+ CD133+ hematopoietic stem cells cultured with growth factors including Angptl5 efficiently engraft adult NOD-SCID Il2rgamma-/- (NSG) mice PMID:21559522
  15. IL-2 receptor complex has an essential protective role in immunity to blood-stage malaria. Protection is achieved by gammac cytokine family members signalling through the IL-2Rgammac. PMID:21585397
  16. Hematopoietic stem cells -infused HLA-DR4.NOD.Rag1knockout (KO) .IL-2RgammacKO mice developed a very high reconstitution rate (>90%) with long-lived and functional human T and B cells. PMID:21611197
  17. Results reflect the suppression of the leaky phenomenon in NOG mice through the inactivation of the IL-2Rgamma gene, which is commonly expressed in T and B cell growth factor receptors to IL-2, IL-4 and IL-7. PMID:21512274
  18. IL2Rgamma and its co-receptor IL15Ralpha are localized along with interleukin-15 in cerebral endothelia during robust upregulation of neuroinflammation. PMID:21155807
  19. IL2Rgamma KO mice showed more depressive-like behavior than controls in both genders, and male mice showed improved contextual fear memory. PMID:20438766
  20. gamma c deficiency precludes CD8+ T cell memory despite formation of potent T cell effectors. PMID:20439728
  21. dengue virus infection and virus-specific HLA-A2 restricted immune response does not require IL2rgamma PMID:19802382
  22. These data suggest that IRS-dependent signaling pathways work by recruiting different signaling molecules to determine specificity of IL-2R gamma superfamily cytokines. PMID:11788580
  23. Structural basis for binding multiple ligands by the common cytokine receptor gamma-chain PMID:11815609
  24. The estrous cycles in gamma(c) knockout (gamma(c) KO) mice were irregular compared with wild-type mice, although, the mutants could become pregnant. PMID:12069389
  25. Effector mechanisms in nonobese diabetic (NOD) hosts are inherently complex, and islet allograft rejection in this model involves common gamma-chain-dependent and -independent mechanisms. PMID:14500690
  26. Although IL-2 has been reported to influence natural killer (NK) cell differentiation, mice deficient in IL-2 common gamma chain receptor subunit have normal NK cell numbers, phenotype, and effector functions. PMID:15661875
  27. Colonic IL-6-producing thymus-derived CD4 + T cells are responsible for the development of colitis in CR gamma -/Y mice. PMID:15825075
  28. Stat5 has a role in severe combined immunodeficiency, similar in many respects to the roles of IL-7R, gammac, and Jak3 PMID:16418296
  29. Different gamma chain cytokines regulate regulatory T cell homeostasis in the periphery by differentially regulating survival and proliferation. PMID:18304352
  30. naive T cells can be induced to undergo homeostatic proliferation of variable speed with a few members of the common gamma-chain (CD132) family of cytokines, the speed of proliferation depending on the levels of the particular cytokine involved. PMID:18390713
  31. Evidence supports complementary and essential roles for IL2Rg and FMS-like tyrosine kinase 3 ligand Flt3l in regulation of developing thymic and bone marrow natural killer (NK) cell compartments. PMID:19155493
  32. High expression of the cytokine receptor common gamma-chain confers longevity of intestinal eosinophils and suggests that common gamma-chain-dependent tissue- intrinsic signals contribute to eosinophil homeostasis. PMID:19843944

Show More

Hide All

Subcellular Location
Cell membrane; Single-pass type I membrane protein. Cell surface.
Protein Families
Type I cytokine receptor family, Type 5 subfamily
Database Links

UNIGENE: Mm.2923

KEGG: mmu:16186

STRING: 10090.ENSMUSP00000033664

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products