WSSKVLMSSANEDIKADLILTSTAPEHLSAPTLPLPEVQCFVFNIEYMNCTWNSSSEPQATNLTLHYRYKVSDNNTFQECSHYLFSKEITSGCQIQKEDIQLYQTFVVQLQDPQKPQRRAVQKLNLQNLVIPRAPENLTLSNLSESQLELRWKSRHIKERCLQYLVQYRSNRDRSWTELIVNHEPRFSLPSVDELKRYTFRVRSRYNPICGSSQQWSKWSQPVHWGSHTVEENPSLFALEAVLIPVGTMGLIITLIFVYCWLERMPPIPPIKNLEDLVTEYQGNFSAWSGVSKGLTESLQPDYSERFCHVSEIPPKGGALGEGPGGSPCSLHSPYWPPPCYSLKPEA
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Common subunit for the receptors for a variety of interleukins. Probably in association with IL15RA, involved in the stimulation of neutrophil phagocytosis by IL15.
Gene References into Functions
Suggest that soluble common gamma chain may be one of the target molecules for the control of immunopathogenic progresses in COPD.PMID:28331303
degree to which immune rejection contributes to these disappointing outcomes using an immunodeficient IL2 receptor gamma (IL2rgamma)-null mouse model, was examined.PMID:28089909
We have confirmed the activation of human peripheral blood lymphocytes after being xenografted in immunodeficient Rag2-/-IL2Rgnull mice.PMID:26113085
Results demonstrate that IL2Rgamma has an onogenic role in JAK3-mutation-positive leukemias.PMID:25109334
findings demonstrate that NOD SCID IL2R common gamma chain -/- mice are capable of engraftment of canine PBLs yet develop graft versus host disease similar to Hu-PBL-SCID micePMID:24368085
Human colon cancer xenografts propagated in NSG and NRG mice maintain structural fidelity while replacing human stromal cells with murine stromal cells.PMID:24798995
The potential for dysregulated T cell and dendritic cell (DC) activation in the gamma(c)-deficient environment leading to allergic lung inflammation.PMID:23940740
gammac expression was required to signal the differentiation of MHC class I-specific thymocytes into CD8+ cytotoxic lineage T cells and into invariant natural killer T cells.PMID:23109710
critical for intestinal T-cell reconstitution in humanized micePMID:22569301
analysis of multiorgan metastasis of human HER-2+ breast cancer in Rag2-/-;Il2rg-/- mice and treatment with PI3K inhibitorPMID:22737248
Results indicated that the extracellular and transmembrane domains of gammaC and IL-13Ralpha1 controlled the magnitude of the intracellular signaling response to IL-4 and IL-13.PMID:22829596
physiologic impact of CB hematopoietic progenitor cell hypofucosylation was investigated in vivo in NOD-SCID interleukin (IL)-2Rgamma(null) (NSG) micePMID:22306295
Letter: Hyperglycemia-induced proliferation of adult human beta cells engrafted into spontaneously diabetic immunodeficient NOD-Rag1null IL2rgammanull Ins2Akita mice.PMID:21926555
CD34+ CD133+ hematopoietic stem cells cultured with growth factors including Angptl5 efficiently engraft adult NOD-SCID Il2rgamma-/- (NSG) micePMID:21559522
IL-2 receptor complex has an essential protective role in immunity to blood-stage malaria. Protection is achieved by gammac cytokine family members signalling through the IL-2Rgammac.PMID:21585397
Hematopoietic stem cells -infused HLA-DR4.NOD.Rag1knockout (KO) .IL-2RgammacKO mice developed a very high reconstitution rate (>90%) with long-lived and functional human T and B cells.PMID:21611197
Results reflect the suppression of the leaky phenomenon in NOG mice through the inactivation of the IL-2Rgamma gene, which is commonly expressed in T and B cell growth factor receptors to IL-2, IL-4 and IL-7.PMID:21512274
IL2Rgamma and its co-receptor IL15Ralpha are localized along with interleukin-15 in cerebral endothelia during robust upregulation of neuroinflammation.PMID:21155807
IL2Rgamma KO mice showed more depressive-like behavior than controls in both genders, and male mice showed improved contextual fear memory.PMID:20438766
gamma c deficiency precludes CD8+ T cell memory despite formation of potent T cell effectors.PMID:20439728
dengue virus infection and virus-specific HLA-A2 restricted immune response does not require IL2rgammaPMID:19802382
These data suggest that IRS-dependent signaling pathways work by recruiting different signaling molecules to determine specificity of IL-2R gamma superfamily cytokines.PMID:11788580
Structural basis for binding multiple ligands by the common cytokine receptor gamma-chainPMID:11815609
The estrous cycles in gamma(c) knockout (gamma(c) KO) mice were irregular compared with wild-type mice, although, the mutants could become pregnant.PMID:12069389
Effector mechanisms in nonobese diabetic (NOD) hosts are inherently complex, and islet allograft rejection in this model involves common gamma-chain-dependent and -independent mechanisms.PMID:14500690
Although IL-2 has been reported to influence natural killer (NK) cell differentiation, mice deficient in IL-2 common gamma chain receptor subunit have normal NK cell numbers, phenotype, and effector functions.PMID:15661875
Colonic IL-6-producing thymus-derived CD4 + T cells are responsible for the development of colitis in CR gamma -/Y mice.PMID:15825075
Stat5 has a role in severe combined immunodeficiency, similar in many respects to the roles of IL-7R, gammac, and Jak3PMID:16418296
Different gamma chain cytokines regulate regulatory T cell homeostasis in the periphery by differentially regulating survival and proliferation.PMID:18304352
naive T cells can be induced to undergo homeostatic proliferation of variable speed with a few members of the common gamma-chain (CD132) family of cytokines, the speed of proliferation depending on the levels of the particular cytokine involved.PMID:18390713
Evidence supports complementary and essential roles for IL2Rg and FMS-like tyrosine kinase 3 ligand Flt3l in regulation of developing thymic and bone marrow natural killer (NK) cell compartments.PMID:19155493
High expression of the cytokine receptor common gamma-chain confers longevity of intestinal eosinophils and suggests that common gamma-chain-dependent tissue- intrinsic signals contribute to eosinophil homeostasis.PMID:19843944
Show
More
Hide
All
Subcellular Location
Cell membrane; Single-pass type I membrane protein. Cell surface.