Recombinant Mouse Cytochrome b-245 heavy chain (Cybb)

Code: CSB-CF733771MO
Size:
20μg
20μg100μg
US$6760
Quantity:
Express system: in vitro E.coli expression system
Species: Mus musculus (Mouse)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
Cybb
Uniprot NO.
Alternative Names
Cybb; Cgd; Cytochrome b-245 heavy chain; CGD91-phox; Cytochrome b(558 subunit beta; Cytochrome b558 subunit beta; Heme-binding membrane glycoprotein gp91phox; Neutrophil cytochrome b 91 kDa polypeptide; gp91-1; gp91-phox; p22 phagocyte B-cytochrome
Species
Mus musculus (Mouse)
Source
in vitro E.coli expression system
Expression Region
1-570
Target Protein Sequence
MGNWAVNEGLSIFVILVWLGLNVFLFINYYKVYDDGPKYNYTRKLLGSALALARAPAACL NFNCMLILLPVCRNLLSFLRGSSACCSTRIRRQLDRNLTFHKMVAWMIALHTAIHTIAHL FNVEWCVNARVGISDRYSIALSDIGDNENEEYLNFAREKIKNPEGGLYVAVTRLAGITGI VITLCLILIITSSTKTIRRSYFEVFWYTHHLFVIFFIGLAIHGAERIVRGQTAESLEEHN LDICADKIEEWGKIKECPVPKFAGNPPMTWKWIVGPMFLYLCERLVRFWRSQQKVVITKV VTHPFKTIELQMKKKGFKMEVGQYIFVKCPKVSKLEWHPFTLTSAPEEDFFSIHIRIVGD WTEGLFNACGCDKQEFQDAWKLPKIAVDGPFGTASEDVFSYEVVMLVGAGIGVTPFASIL KSVWYKYCDNATSLKLKKIYFYWLCRDTHAFEWFADLLQLLETQMQERNNANFLSYNIYL TGWDESQANHFAVHHDEEKDVITGLKQKTLYGRPNWDNEFKTIASEHPNTTIGVFLCGPE ALAETLSKQSISNSESGPRGVHFIFNKENF
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Critical component of the membrane-bound oxidase of phagocytes that generates superoxide. It is the terminal component of a respiratory chain that transfers single electrons from cytoplasmic NADPH across the plasma membrane to molecular oxygen on the exterior. Also functions as a voltage-gated proton channel that mediates the H(+) currents of resting phagocytes.
Gene References into Functions
  1. Combination of exogenous and endogenous environmental factors with minimally toxic dose synergistically propagates dopaminergic neurodegeneration through activating microglial NOX2. PMID:27975175
  2. Reducing NADPH oxidase-2 by impeding p67(phox) activation in infected mouse macrophages reduced viral entry and inflammation. PMID:29524539
  3. the study reports a novel mechanistic pathway of leptin-mediated renal inflammation that is dependent on NOX-2-miR21 axis in ectopic manifestations underlying non-alcoholic fatty liver disease-induced co-morbidities PMID:29660503
  4. Whereas the oxidative burst in myeloid cells is mainly catalyzed by the NOX2 isotype, in epithelial cells other isotypes of the NADPH oxidases family are involved, especially NOX4 PMID:29734661
  5. Proximal point of bifurcation in cardiac insulin signaling through the simultaneous activation of both NOX2 and NOX4 was identified. Each NOX isoform generates H2O2 in cardiac myocytes with distinct time courses, with H2O2 derived from NOX2 augmenting Akt-dependent metabolic effects of insulin, while H2O2 from NOX4 blocks beta adrenergic increases in inotropy. PMID:28917508
  6. AIF activated AMPK-dependent Nox2 signaling pathway. PMID:29477034
  7. Nox2 may be a therapeutic target for AII-induced skeletal muscle atrophy. PMID:29487866
  8. These results indicated that integrin CD11b mediates alpha-synuclein-induced NOX2 activation through a RhoA-dependent pathway. PMID:29154191
  9. These results showed that CR3 regulated Nox2 activation and dopaminergic neurodegeneration through a Src-Erk-dependent pathway in a two pesticide-induced Parkinson's disease (PD) model, providing novel insights into the immune pathogenesis of PD. PMID:28978491
  10. High levels of NOX2 were found in mouse adult neurogenic brain regions. NOX2-deficient brain showed decrease in neuroprecursor cell pool and lowered expression of genes involved in neural differentiation. PMID:28575744
  11. Echocardiography revealed that ALDH-2(-/-)/gp91(phox-/-) mice were protected from ACA-overload-induced HF after 5 weeks of 2% EtOH-diet, demonstrating that NOX2-derived O2(*-) contributes to the development of ACM PMID:27624556
  12. Nox2 activation favors thioredoxin-1 (TRX-1)/p40phox interaction, which leads to exclusion of TRX-1 from the nucleus. PMID:27698473
  13. these observations indicate that Nox2-mediated ROS production promotes arterial EC specification in differentiating miPSCs by activating the Notch signaling pathway and contributes to the angiogenic potency of transplanted miPSC-derived ECs. PMID:27642005
  14. in addition to a secretory role, VAMP8-mediates trafficking of NOX2 to endosomes and phagosomes and this promotes induction of cytolytic T cell immune responses PMID:28688576
  15. This study for the first time establishes the significant role of Nox2 in mediating the NE-induced pathological adrenergic signaling in cardiac myoblasts. PMID:28593564
  16. We propose that NOX2-derived ROS facilitate metastasis of melanoma cells by downmodulating NK-cell function and that inhibition of NOX2 may restore IFNgamma-dependent, NK cell-mediated clearance of melanoma cells PMID:28760732
  17. NOX2 knockout mice was used to study the role of NOX2 in mediating NLRP3 inflammasome expression and activation following a controlled cortical impact. PMID:28785377
  18. Myricitrin attenuated the generation of intracellular ROS by inhibiting the assembly of components of the gp91(phox) and p47(phox). Suppression of ROS generation using NAC or apocynin or by silencing gp91(phox) and p47(phox) all demonstrated that decreasing the level of ROS inhibited the LPS-induced inflammatory response. PMID:28751937
  19. Ablation of NOX2 prevented inflammation-induced axon initial segment plasticity. PMID:28595650
  20. the present study suggests that acute lung injury-induced upregulation of neutrophilic and neuronal NOX-2 may contribute to depression-like symptoms in mice PMID:28433943
  21. Findings indicate that microglial NOX2-generated H2O2 is able to regulate the immunological functions of astroglia via a STAT1/3-dependent mechanism. PMID:28237879
  22. Role of Protein Kinase C and Nox2-Derived Reactive Oxygen Species Formation in the Activation and Maturation of Dendritic Cells by Phorbol Ester and Lipopolysaccharide. PMID:28458776
  23. this study shows that neutrophil pyroptosis mediates pathology of Pseudomonas aeruginosa lung infection in the absence of the NADPH oxidase NOX2 PMID:27554297
  24. Data indicate that increased NADPH oxidase activity after traumatic brain injury drives M1-like activation in microglia/macrophages that contributes to inflammatory-mediated neurodegeneration. PMID:27477920
  25. Neurofibromin regulates macrophage superoxide production via p21Ras.Neurofibromin-deficient smooth muscle cells are sensitive to oxidative stress.NADPH oxidase 2 is required for NF1 arterial stenosis.Neurofibromatosis type 1 patients have evidence of chronic oxidative stress. PMID:27266634
  26. We examined the pattern of NOX expression in spinal cords of patients and mouse models of ALS and analyzed the impact of genetic deletion of the NOX1 and 2 isoforms as well as pharmacological NOX inhibition in the SOD1(G93A) ALS mouse model.In contrast to previous publications, survival of SOD1(G93A) mice was not modified upon breeding with constitutive NOX1 and NOX2 deficient mice. PMID:27212019
  27. Spinal cord injury leads to a significant increase in NOX2 expression. The reduction in M2 polarization is associated with a peak in NOX2 expression. PMID:27729244
  28. NOX2 has a role in leukocyte activation and in thrombus formation PMID:26786324
  29. mice deficient in reactive oxygen species production by NOX2 due to the absence of the gp91 subunit had significantly more severe pathology in the later stages of infection with Leishmania amazonensis PMID:29158417
  30. indicate that following traumatic brain injury NOX2 inhibition promotes a robust anti-inflammatory response in macrophages/microglia that is mediated by the IL-10/STAT3 signaling pathway PMID:28340575
  31. The results suggest that Nrf2 is an important regulator of the retinal milieu during tissue ischemia, and that the Nrf2/NOX2 balance may play a critical role in determining the fate of ischemic revascularization. PMID:27521459
  32. North American ginseng inhibits myocardial NOX2-ERK1/2-TNF-alpha signaling pathway and improves cardiac function in endotoxemia, suggesting that NA ginseng may have the potential in the prevention of clinical sepsis. PMID:27317946
  33. Study demonstrate that Nox2 signaling via inactivation of phosphatase and tensin homolog and activation of the PI3K/Akt pathway leads to membrane ruffling and macropinocytosis. PMID:27488058
  34. our results demonstrate that 5-HT induces the invasion of commensal E. coli into gut submucosa by amplifying commensal bacteria-induced epithelial signaling (superoxide production and the inductions of NOX2 and TLR2/TLR4). The authors suggest that these changes may constitute the molecular basis for the pathogenesis of inflammatory bowel disease (IBD). PMID:28216386
  35. we used the Ang II infused hph-1 mice to examine the roles of NOX isoforms in the development of AAA. We generated double mutants of hph-1-NOX1, hph-1-NOX2, hph-1-p47phox, and hph-1-NOX4 PMID:27912196
  36. Virus infection activates endosomal NOX2 oxidase and restricts TLR7 signaling, and that an endosomal NOX2 inhibitor decreases viral pathogenicity. PMID:28701733
  37. These data suggest that endothelial SHIP2 is required to maintain normal systemic glucose homeostasis and prevent oxidative stress-induced endothelial dysfunction. PMID:28830894
  38. NOX2 is a negative regulator of maximal glucose stimulation of insulin secretion in C57BL/6J mouse islets. PMID:27664519
  39. Acute myeloid leukemia cells -derived NOX2 drives transfer of mitochondria via the generation of superoxide. PMID:28733324
  40. Nox2- and Nox4-derived reactive oxygen species contribute to stem cell pluripotency maintenance and self-renewal. PMID:27797149
  41. Redox-dependent regulation of EGFR activation in airway epithelial cells was found to strongly depend on activation of either DUOX1 or NOX2. PMID:27650496
  42. NOX2 signaling in macrophages participates in the pathogenesis of obesity, and reinforce a key role for macrophage inflammation in diet-induced metabolic and neurologic decline PMID:28771483
  43. Studies in knockout and knock-in mice showed that the phospholipase A2 activity of peroxiredoxin 6 activates NOX2 in cultured pulmonary endothelial cells and alveolar macrophages, clarifying the metabolism of lysophosphatidyl chold to lysophosphatidic acid. PMID:27178323
  44. NOX2 knockout mice had significantly lower blood pressure than littermate controls, with both endothelial cells and myeloid cells having a deficiency in NOX2. PMID:28298457
  45. Data show that pan-NOX-inhibitor APX-115 treatment decreased NADPH oxidase (Nox) Nox1, Nox2, and Nox4 protein expression in the kidney. PMID:28165467
  46. NOX2 regulates proinflammatory TLR signaling and alveolar remodeling induced by a single dose of lipopolysaccharides. PMID:27438994
  47. a deficiency in MyD88 or CybB is associated with impaired bacterial clearance and increased granuloma formation in the lung. PMID:27607191
  48. NOX2 isoform was first discovered as a component of the oxidative burst in neutrophils and is a complex consisting of several cytosolic subunits (p47phox, p67phox, p40phox, and Rac1 or Rac2) and a membrane-associated cytochrome b558 reductase made up of gp91phox and p22phox subunits. PMID:26757359
  49. Macrophage-produced HMGB1 leads to aortic inflammation and acts as a trigger for CD4(+) T-cell-produced IL-17 during abdominal aortic aneurysm formation. HMGB1 release is dependent on Nox2 activation, which can be inhibited by MSCs leading to attenuation of proinflammatory cytokines and protection against AAA formation. PMID:26988591
  50. NOX2 is important for ROS generation induced by both the GPCR and the GPVI/ITAM signaling pathways in blood platelets. PMID:26988594

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products