Home
Product
Protein
Transmembrane Proteins
Recombinant Mouse Cyclic nucleotide-gated cation channel beta-3 (Cngb3)

Recombinant Mouse Cyclic nucleotide-gated cation channel beta-3 (Cngb3)

Code: CSB-CF881328MO

Rate （N/A）
Review （0）

Size:

20μg100μg

US$7688

Quantity:

Express system: in vitro E.coli expression system

Species: Mus musculus (Mouse)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

Cngb3

Uniprot NO.

Q9JJZ9

Alternative Names

Cngb3; Cng6; Cyclic nucleotide-gated cation channel beta-3; Cone photoreceptor cGMP-gated channel subunit beta; Cyclic nucleotide-gated cation channel modulatory subunit; Cyclic nucleotide-gated channel beta-3; CNG channel beta-3; Cyclic nucleotide-gated channel subunit CNG6

Species

Mus musculus (Mouse)

Source

in vitro E.coli expression system

Expression Region

1-694

Target Protein Sequence

MLKSLTVKFNKVNPMEGRMEKKLCPNLSSLSQPTIAQGDNQSEKEPLRSRTPITFEKSHS KEDNSTGENSLRDFTPNPDPECRAELTRTMAEMEKTRTGKERPVSFKTKVLETSIINEYT DAHLHNLVERMRERTALYKKTLTEEENFPEVEASSQTAMSTNISPKQENNSKLKEHQDTF SFKPQRVPVKEHLRRMILPRSIDSYTDRVYLLWLLLVTIAYNWNCWLLPVRLVFPCQTPD NKNYWIITDIVCDIIYLCDILLIQPRLQFVRGGEIIVDSNELKRNYRSSTKFRMDVASLL PFEVLYIFFGVNPIFRANRILKYTSFFEFNHHLESIMDKAYVYRVIRTTGYLLFLLHINA CVYYWASDYEGIGSTKWVYNGEGNKYLRCFYWAVRTLITIGGLPEPQTSFEIVFQFLNFF SGVFVFSSLIGQMRDVIGAATANQNYFQACMDHIIAYMNKYSIPQSVQYRVRTWLEYTWN SQRILDESNLLENLPTAMQLSIALDINFSIIDKVELFKGCDTQMIYDLLLRLKSTIYLPG DFVCKKGEIGKEMYIIKHGEVQVLGGPDGAQVLVTLKAGSVFGEISLLAKGGGNRRTADV VAHGFANLLTLDKKTLQEILLHYPTSKKLLMKKAKILLSQKGKTTQAIPARPGPAFLFPP KEETPRMLKVLLGNTGKVDLGRLLKGKRKTTTQK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Visual signal transduction is mediated by a G-protein coupled cascade using cGMP as second messenger. This protein can be activated by cGMP which leads to an opening of the cation channel and thereby causing a depolarization of rod photoreceptors. Essential for the generation of light-evoked electrical responses in the red-, green- and blue sensitive cones. Induced a flickering channel gating, weakened the outward rectification in the presence of extracellular calcium, increased sensitivity for L-cis diltiazem and enhanced the cAMP efficacy of the channel when coexpressed with CNGA3.

Gene References into Functions

CNGB3 regulates cone light response kinetics and the channel structural flexibility. PMID:26893377
This work investigated the functional modulation of cone CNG channel by exploring the channel-interacting proteins. PMID:24664681
Cone CNG channel is a heterotetrameric complex likely at a stoichiometry of three CNGA3 and one CNGB3. PMID:22183405
RDS does not interact with the cone CNG. PMID:20238003
The heteromeric cyclic nucleotide-gated channel adopts a 3A:1B stoichiometry PMID:12432397