Recombinant Mouse Cyclic nucleotide-gated cation channel beta-3 (Cngb3)

Code: CSB-CF881328MO
Size:
20μg
20μg100μg
US$7688
Quantity:
Express system: in vitro E.coli expression system
Species: Mus musculus (Mouse)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
Cngb3
Uniprot NO.
Alternative Names
Cngb3; Cng6; Cyclic nucleotide-gated cation channel beta-3; Cone photoreceptor cGMP-gated channel subunit beta; Cyclic nucleotide-gated cation channel modulatory subunit; Cyclic nucleotide-gated channel beta-3; CNG channel beta-3; Cyclic nucleotide-gated channel subunit CNG6
Species
Mus musculus (Mouse)
Source
in vitro E.coli expression system
Expression Region
1-694
Target Protein Sequence
MLKSLTVKFNKVNPMEGRMEKKLCPNLSSLSQPTIAQGDNQSEKEPLRSRTPITFEKSHS KEDNSTGENSLRDFTPNPDPECRAELTRTMAEMEKTRTGKERPVSFKTKVLETSIINEYT DAHLHNLVERMRERTALYKKTLTEEENFPEVEASSQTAMSTNISPKQENNSKLKEHQDTF SFKPQRVPVKEHLRRMILPRSIDSYTDRVYLLWLLLVTIAYNWNCWLLPVRLVFPCQTPD NKNYWIITDIVCDIIYLCDILLIQPRLQFVRGGEIIVDSNELKRNYRSSTKFRMDVASLL PFEVLYIFFGVNPIFRANRILKYTSFFEFNHHLESIMDKAYVYRVIRTTGYLLFLLHINA CVYYWASDYEGIGSTKWVYNGEGNKYLRCFYWAVRTLITIGGLPEPQTSFEIVFQFLNFF SGVFVFSSLIGQMRDVIGAATANQNYFQACMDHIIAYMNKYSIPQSVQYRVRTWLEYTWN SQRILDESNLLENLPTAMQLSIALDINFSIIDKVELFKGCDTQMIYDLLLRLKSTIYLPG DFVCKKGEIGKEMYIIKHGEVQVLGGPDGAQVLVTLKAGSVFGEISLLAKGGGNRRTADV VAHGFANLLTLDKKTLQEILLHYPTSKKLLMKKAKILLSQKGKTTQAIPARPGPAFLFPP KEETPRMLKVLLGNTGKVDLGRLLKGKRKTTTQK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Visual signal transduction is mediated by a G-protein coupled cascade using cGMP as second messenger. This protein can be activated by cGMP which leads to an opening of the cation channel and thereby causing a depolarization of rod photoreceptors. Essential for the generation of light-evoked electrical responses in the red-, green- and blue sensitive cones. Induced a flickering channel gating, weakened the outward rectification in the presence of extracellular calcium, increased sensitivity for L-cis diltiazem and enhanced the cAMP efficacy of the channel when coexpressed with CNGA3.
Gene References into Functions
  1. CNGB3 regulates cone light response kinetics and the channel structural flexibility. PMID:26893377
  2. This work investigated the functional modulation of cone CNG channel by exploring the channel-interacting proteins. PMID:24664681
  3. Cone CNG channel is a heterotetrameric complex likely at a stoichiometry of three CNGA3 and one CNGB3. PMID:22183405
  4. RDS does not interact with the cone CNG. PMID:20238003
  5. The heteromeric cyclic nucleotide-gated channel adopts a 3A:1B stoichiometry PMID:12432397

Show More

Hide All

Subcellular Location
Membrane; Multi-pass membrane protein.
Protein Families
Cyclic nucleotide-gated cation channel (TC 1.A.1.5) family, CNGB3 subfamily
Tissue Specificity
Small subset of retinal photorecptor cells and testis.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products