Home
Product
Protein
Transmembrane Proteins
Recombinant Mouse Cyclic nucleotide-gated cation channel alpha-3 (Cnga3)

Recombinant Mouse Cyclic nucleotide-gated cation channel alpha-3 (Cnga3)

Code: CSB-CF888333MO

Rate （N/A）
Review （0）

Size:

20μg100μg

US$7216

Quantity:

Express system: in vitro E.coli expression system

Species: Mus musculus (Mouse)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

Cnga3

Uniprot NO.

Q9JJZ8

Alternative Names

Cnga3; Cng3; Cyclic nucleotide-gated cation channel alpha-3; Cone photoreceptor cGMP-gated channel subunit alpha; Cyclic nucleotide-gated channel alpha-3; CNG channel alpha-3; CNG-3; CNG3

Species

Mus musculus (Mouse)

Source

in vitro E.coli expression system

Expression Region

1-631

Target Protein Sequence

MAKVNTQCSQPSPTQLSIKNADRDLDHVENGLGRVSRLIISIRAWASRHLHDEDQTPDSF LDRFHGSELKEVSTRESNAQPNPGEQKPPDGGEGRKEEPIVVDPSSNIYYRWLTAIALPV FYNWCLLVCRACFDELQSEHLTLWLVLDYSADVLYVLDMLVRARTGFLEQGLMVRDTKRL WKHYTKTLHFKLDILSLIPTDLAYLKLGVNYPELRFNRLLKFSRLFEFFDRTETRTNYPN VFRIGNLVLYTLIIIHWNACIYFAISKFIGFGTDSWVYPNTSKPEYARLSRKYIYSLYWS TLTLTTIGETPPPVKDEEYLFVVIDFLVGILIFATIVGNVGSMISNMNAPRVEFQAKIDS VKQYMQFRKVTKDLETRVIRWFDYLWANRKTVDEKEVLKNLPDKLKAEIAINVHLDTLKK VRIFQDCEAGLLVELVLKLRPTVFSPGDYICKKGDIGREMYIIKEGKLAVVADDGVTQFV VLSDGSYFGEISILNIKGSKSGNRRTANIRSIGYSDLFCLSKDDLMEALTEYPDAKRALE EKGRQILMKDNLIDEDLVAARVDTRDVEEKVEYLESSLDILQTRFARLLAEYSASQMKLK QRLTRLESQMNRRCCGFSPDRENSEDASKTD
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Visual signal transduction is mediated by a G-protein coupled cascade using cGMP as second messenger. This protein can be activated by cyclic GMP which leads to an opening of the cation channel and thereby causing a depolarization of cone photoreceptors. Essential for the generation of light-evoked electrical responses in the red-, green- and blue sensitive cones. Induced a flickering channel gating, weakened the outward rectification in the presence of extracellular calcium, increased sensitivity for L-cis diltiazem and enhanced the cAMP efficacy of the channel when coexpressed with CNGB3.

Gene References into Functions

AAV8 with capsid Y-F and T-V mutations may be one of the most effective AAV vectors for long-term treatment in a naturally occurring mouse model of CNGA3 achromatopsia PMID:29131863
CNGA3 expression restored cone function in in CNGA3-/-/Nrl-/- mice, an all-cone model of CNGA3 achromatopsia. PMID:25855802
cGMP/protein kinase G signaling suppresses Itpr1 phosphorylation and promotes endoplasmic reticulum stress in photoreceptors of Cnga3-deficient mice. PMID:26124274
Homologous to the human disease, CNGA3 deficient mice reveal a loss of cone specific functionality leading to degeneration of affected cone photoreceptors. (review) PMID:24658860
This work investigated the functional modulation of cone CNG channel by exploring the channel-interacting proteins. PMID:24664681
The results of this study indicated that cGMP accumulation in photoreceptors can itself exert cytotoxic effect in cones, independently of CNG channel activity and Ca(2+) influx. PMID:24027293
observed a nuclear translocation of apoptosis-inducing factor (AIF) and endonuclease G in CNGA3(-/-)/Nrl(-/-) and CNGB3(-/-)/Nrl(-/-) retinas, implying a mitochondrial insult in the endoplasmic reticulum stress-activated cell death process PMID:22493484
Pull-down assays indicated that the binding to organ of Corti CNGA3 was attributable to the EMILIN1 intracellular sequence that follows a predicted transmembrane domain in the C-terminus PMID:22248097
Cone CNG channel is a heterotetrameric complex likely at a stoichiometry of three CNGA3 and one CNGB3. PMID:22183405
This study provided evidence that CNGA3 contributes in an inhibitory manner to the central sensitization of pain pathways during inflammatory pain as a target of NO/cGMP signaling. PMID:21813679
The wild type and mutant CNGA3 were expressed in HEK293 cells, the channel's expression and cellular localization were examined by immunoblotting and immunofluorecences labeling, and activity of the channel was evaluated. PMID:20238023
our data describe a so far unrecognized role of CNGA3 in modulation of hippocampal plasticity and amygdala-dependent fear memory PMID:20846178
Data show that visual responses in TKO mice extend beyond the retina to encompass the lateral margins of the lateral geniculate nucleus and components of the visual cortex. PMID:21124780
CNGA3 was strongly expressed in the Grueneberg ganglion and the expression of CNGA3 was confined to those cells that are responsive to coolness PMID:20165899
R377W and F488L mutations in the C-terminus of CNGA3 cause the loss of functional activity of the channels PMID:20088482
The results show that cone bipolar cells in CNGA3(-/-) mice form ectopic synapses with rods. PMID:16687517
Thus this work provides the first biochemical evidence showing the inter-subunit interaction between CNGA3 and CNGB3 and the presence of heterotetrameric complexes of the native cone CNG channel in retina. PMID:18665891