VAQPGQAPQDQPLWTLLEQYCHRTTIGNFSGPYTYCNTTLDQIGTCWPQSAPGALVERPC PEYFNGIKYNTTRNAYRECLENGTWASRVNYSHCEPILDDKQRKYDLHYRIALIVNYLGH CVSVVALVAAFLLFLVLRSIRCLRNVIHWNLITTFILRNIAWFLLQLIDHEVHEGNEVWC RCITTIFNYFVVTNFFWMFVEGCYLHTAIVMTYSTEHLRKWLFLFIGWCIPCPIIIAWAV GKLYYENEQCWFGKEAGDLVDYIYQGPVMLVLLINFVFLFNIVRILMTKLRASTTSETIQ YRKAVKATLVLLPLLGITYMLFFVNPGEDDLSQIVFIYFNSFLQSFQGFFVSVFYCFFNG EVRAALRKRWHRWQDHHALRVPVARAMSIPTSPTRISFHSIKQTAAV
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
G-protein coupled receptor for CRH (corticotropin-releasing factor), UCN (urocortin), UCN2 and UCN3. Has high affinity for UCN. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and down-stream effectors, such as adenylate cyclase. Promotes the activation of adenylate cyclase, leading to increased intracellular cAMP levels.
Gene References into Functions
CRFR2-expressing neurons within the posterior bed nucleus of the stria terminalis (pBNST) send dense inhibitory projections to other stress-related brain regions. Local CRFR2 activation by urocortin 3 depolarized the cells, increased the neuronal input resistance and increased firing of action potentials. Optogenetic activation of CRFR2 neurons in the pBNST decreased anxiety and attenuated stress responses.PMID:27550842
Urocortin 2 acts on gonadotrophs expressing the corticotropin-releasing factor type 2 receptor, and inhibits the production of gonadotropins in the pituitary gonadotropic tumor cells.PMID:28851616
Results indicate that corticotropin releasing hormone receptor 2 (Crhr2) is highly expressed in cardiomyocytes, and cardiomyocyte-specific deletion of Crhr2 protected mice from pressure overload-induced cardiac dysfunction.PMID:28550160
findings collectively suggest that the MeA Ucn3-CRF-R2 system modulates the ability of mice to cope with social challengesPMID:27428651
Study suggests that selective CRF2 receptor agonists urocortin 2 and 3 could be used as a therapy in nicotine addiction.PMID:27693397
results indicate that long-term UVA eye irradiation led to increased gp91phox-derived ROS in the brain and the increased expression of urocortin 2 and CRHR type 2, resulting in photoaging; however, further studies are needed to confirm these findingsPMID:26648475
Crhr2(-/-) mice showed increased mortality in the dextran sodium sulfate healing protocolPMID:26597886
the inhibitory effect of CRFR2 signaling on insulin action is mediated by cAMP in a mammalian target of rapamycin-dependent manner.PMID:25875045
Data suggest that signal transduction via ghrelin and Crhr2 plays role in regulation of muscle glucose metabolism; Ghsr1a (ghrelin receptor type 1A) was not detected in mouse myoblast cell line (C2C12) investigated.PMID:23804489
The receptors' binding specificity and structural studies were performed using full-length human CRFR1alpha and mouse CRFR2beta as well as fragments lacking the N-terminal extracellular domain.PMID:24465390
estrogens act on ERalpha to up-regulate CRHR2 expression in cardiomyocytes.PMID:24035863
These results provide initial evidence of a gender-independent and specific role for the CRF2 receptor in the motivational effects of opiate withdrawal.PMID:23707482
stress-induced anorexia in A(y)/a mice may be associated with increased anorectic signals mediated by CRFR2 in the hypothalamusPMID:23834894
Brain CRF2 receptors do not tonically promote anxiogenic-like behavior.PMID:24015170
CRF2 receptor-deficient mice lack the dysphoria-like and the anhedonia-like states of opiate withdrawal.PMID:21946917
data show that CRFR2 mRNA upregulation in the BNST coincides with PTSD-like symptoms Theyfurther show that knockdown of CRFR2 in the posterior medial BNST of adult mice reduces susceptibility to PTSD-like behaviors.PMID:22593059
The CRF peptide reduces both apoptotic and necrotic cell death in cardiac myocytes subjected to lethal ischemic induced stress through activation of PKA and PKC dependent signaling pathways downstream of CRFR2.PMID:22209828
CRF(1) agonists, Ucn 1 and stressin(1) -A, reduced feeding and induced interoceptive stress, whereas Ucn 2 potently suppressed feeding via a CRF(2) -dependent mechanism without eliciting malaisePMID:21627635
Type 2 corticotropin-releasing factor receptor in the ventromedial nucleus of hypothalamus is critical in regulating feeding and lipid metabolism in white adipose tissue.PMID:22067315
Urocortin 3 acting on CRFR2 in skeletal muscle of Ucn3(+) mice results in a metabolic phenotype, with lean body composition and protection against diet-induced obesity and hyperglycaemia.PMID:21667214
Data suggest that UCN regulates osteoclast resorption by suppressing osteoclast maturation/function via suppression of constitutively active cation channel (CRFR2beta) with properties of canonical transient receptor potential 1 (TRPC1) channel.PMID:22083217
CRH-R2 participates in sleep-wake regulation via an interaction with the activated immune systemPMID:21704697
CRH-R2 inhibition attenuates stress-induced bacterial growth and significantly prevents severe sepsis.PMID:21774994
The exclusive expression of CRFR2, and not CRFR1, in mature skeletal muscle tissue.PMID:21084379
CRF(2) activation appears to mitigate isolation rearing effects on exploratory behaviorPMID:20466421
The results of this study suggested a novel role for UCN3 and CRH-R2 related to the processing of social cues and to the establishment of social memories.PMID:20610744
Wild type (WT) and CRFR2-KO, but not CRFR1-knockout, mice lost weight during restraint stressPMID:20392192
less abundant than CRHR1 in cerebral microvessels and less prone to changes with developmentPMID:20032050
It was also shown that the activation of CRFR2 could inhibit p38 and Akt phosphorylation to suppress the secretion of VEGF in SCLC cells.PMID:19968503
analysis of circadian heartbeat interval fluctuations indicates that CRFR2-deficiency in mice does not interfere with the dynamical mechanisms underlying the control of heart ratePMID:12637030
CRFR2 plays a critical role in regulation of energy expenditure and is important for responses to homeostatic challenges.PMID:12746321
involvement of CRFR2 in heart rate dynamics upon pharmacological stimulation but demonstrate that CRFR2 is not involved in baseline heart rate regulation and stress-mediated modulation of heart rate responses.PMID:12786991
Evidence is provided for a specific role for CRF receptor type 2 in modulation of dopaminergic neurons of the ventral tegmental area.PMID:12895416
Corticotropin-releasing factor receptor 2 has a role in fear conditioning and stress-enhanced fear conditioning.PMID:14673008
two ligand-selective CRF2 receptor splice variants were found in mice and the CRF2(a) receptor is the predominant central CRF2 receptor in the mouse.PMID:15256278
The role of CRF2 in the defensive startle response in mice.PMID:15269266
analysis of corticotropin-releasing factor receptor type 2alpha genePMID:15514029
identified a cDNA from mouse brain encoding a splice variant, soluble CRFR2alpha (sCRFR2alpha), in which exon 6 is deleted from the gene encoding CRFR2alphaPMID:15701705
Differences in stress sensitivity and the overproduction of CRF of the knockout (KO) mice specifically affects maternal, but not intermale aggression.PMID:15836912
Corticotropin releasing factor over-expression in the mouse brain is associated with up-regulation of CRF2 mRNA.PMID:16423327
crucial role CRFR2 plays in the regulation of regional tissue thermogenesis and adaptive physiologyPMID:16492754
Collectively, these results point toward a role for CRF(2) pathways in neural circuits that subserve stress-coping behaviors.PMID:16507004
CRF(2) agonists appear to have both bronchorelaxant and anti-inflammatory activities and may represent an interesting therapeutic approach to the treatment of inflammatory lung diseases.PMID:16855006
CRHR2 mediates intestinal inflammatory responses via release of proinflammatory mediators at the colonocyte levelPMID:16920976
CRF-R2alpha is present in the cerebellum and functions in circuits that modulate the firing rate of Purkinje cellsPMID:16955482
These results demonstrate for the first time expression of CRF-R2 in the GT1-7 cells and suggest that CRF may directly regulate GnRH gene expression, an effect mediated, at least in part, by CRF-R2.PMID:17175507
Crfr2 is expressed in mouse colon and is overexpressed in altered behavioral response to superimposed mild stressors.PMID:17194724
Stress reduced CRHr in BALB/cByJ mice. In C57BL/6ByJ mice acute stress increased CRHr in portions of the orbital frontal cortex, whereas chronic stress reduced CRHr. CRH(2) expression was unaltered by the stressor in both strains.PMID:17517441
Show
More
Hide
All
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 2 family
Tissue Specificity
Highly expressed in the heart. Also expressed in lungs, skeletal muscle, gastrointestinal tract, epididymis, and brain.