Abbreviation
Recombinant Mouse Cldn6 protein-VLPs (Active)
Purity
Greater than 95% as determined by SEC-HPLC.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
①Measured by its binding ability in a functional ELISA. Immobilized Mouse cldn6 at 5 μg/mL can bind Anti-CLDN6/9 recombinant antibody(CSB-RA005508MA1HU). The EC50 is 4.027-6.270 ng/mL.The VLPs (CSB-MP3838) is negative control. ②Measured by its binding ability in a functional ELISA. Immobilized Mouse cldn6 at 5 μg/mL can bind Anti-CLDN6/9 recombinant antibody(CSB-RA005508MA3HU). The EC50 is 7.349-12.12 ng/mL.The VLPs (CSB-MP3838) is negative control.
Alternative Names
Claudin-6; Skullin; Cldn6
Species
Mus musculus (Mouse)
Expression Region
1-219aa
Target Protein Sequence
MASTGLQILGIVLTLLGWVNALVSCALPMWKVTAFIGNSIVVAQMVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVVTLLIVLLGLLVYLAGAKCTTCVEDRNSKSRLVLISGIIFVISGVLTLIPVCWTAHSIIQDFYNPLVADAQKRELGASLYLGWAASGLLLLGGGLLCCACSSGGTQGPRHYMACYSTSVPHSRGPSEYPTKNYV
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length
Tag Info
C-terminal 10xHis-tagged(This tag can be tested only under denaturing conditions)
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-81°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
CSB-MP3347MO is detected by Mouse anti-6*His monoclonal antibody.
-
Activity
Measured by its binding ability in a functional ELISA. Immobilized Mouse cldn6 at 5 μg/ml can bind Anti-CLDN6/9 recombinant antibody(CSB-RA005508MA1HU). The EC50 is 4.027-6.270 ng/mL.The VLPs (CSB-MP3838) is negative control.
-
Activity
Measured by its binding ability in a functional ELISA. Immobilized Mouse cldn6 at 5 μg/ml can bind Anti-CLDN6/9 recombinant antibody(CSB-RA005508MA3HU). The EC50 is 7.349-12.12 ng/mL.The VLPs (CSB-MP3838) is negative control.
-
The purity of VLPs was greater than 95% as determined by SEC-HPLC
Description
Claudin-6 functions as a tight junction protein with emerging significance in cancer biology, where its aberrant expression marks certain tumor types and positions it as a therapeutic target. This full-length construct (aa 1–219) displays quantifiable binding to anti-CLDN6/9 recombinant antibodies in functional ELISA, with EC50 values of 4.027–6.270 ng/mL and 7.349–12.12 ng/mL depending on antibody format, demonstrating that the protein adopts a conformation recognized by therapeutic-relevant binders. These binding kinetics support use in antibody development and validation workflows, particularly for screening candidate therapeutics against native epitopes, and provide a suitable basis for cell adhesion assays investigating claudin-mediated junction dynamics in tumor models. Mammalian expression yields purity greater than 95% by SEC-HPLC and endotoxin below 1.0 EU/μg, meeting the quality thresholds commonly required for cell-based migration and invasion studies where low endotoxin is critical to avoid confounding inflammatory responses.