Recombinant Mouse Cholecystokinin receptor type A (Cckar)

Code: CSB-CF004772MO
Size:
20μg
20μg100μg
US$5757
Quantity:
Express system: in vitro E.coli expression system
Species: Mus musculus (Mouse)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
Cckar
Uniprot NO.
Species
Mus musculus (Mouse)
Source
in vitro E.coli expression system
Expression Region
1-436
Target Protein Sequence
MDVVDSLLMNGSNITPPCELGLENETLFCLDQPQPSKEWQSAVQILLYSFIFLLSVLGNT LVITVLIRNKRMRTVTNIFLLSLAVSDLMLCLFCMPFNLIPNLLKDFIFGSAVCKTTTYF MGTSVSVSTFNLVAISLERYGAICRPLQSRVWQTKSHALKVIAATWCLSFTIMTPYPIYS NLVPFTKNNNQTANMCRFLLPSDAMQQSWQTFLLLILFLIPGVVMVVAYGLISLELYQGI KFDASQKKSAKEKRLSSGGGGGGGSSSSRYEDSDGCYLQKSRPPRKLELQQLSTSSSGGR INRIRSSGSAANLIAKKRVIRMLIVIVVLFFLCWMPIFSANAWRAYDTVSAEKHLSGTPI SFILLLSYTSSCVNPIIYCFMNKRFRLGFMATFPCCPNPGPTGVRGEVGEEEDGRTIRAS LSRYSYSHMSTSAPPH
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Receptor for cholecystokinin. Mediates pancreatic growth and enzyme secretion, smooth muscle contraction of the gall bladder and stomach. Has a 1000-fold higher affinity for CCK rather than for gastrin. It modulates feeding and dopamine-induced behavior in the central and peripheral nervous system. This receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system.
Gene References into Functions
  1. The studies establish chronic pancreatitis as an IL-33-dependent inflammation resulting from synergistic interactions between the NOD1 and CCKR signaling pathways. PMID:26813347
  2. There is functional synergy between cholecystokinin receptors CCKAR and CCKBR in mammalian brain development. PMID:25875176
  3. mice lacking CCK receptors exhibited a functional shift from the gastrin-CCK pathways to the neuronal pathway in control of the ECL cells and eventually the acid secretion PMID:25160855
  4. cellular and subcellular localization of cholecystokinin (CCK)-1 receptors in the pancreas, gallbladder, and stomach PMID:25249350
  5. CCK-8S increases [Ca(2+)]i in gastric antral interstitial cells of Cajal via the CCK(1) receptor PMID:23326123
  6. CCK1 receptor activation does not have a greater effect combination with upregulated leptin signalling in high-fat-fed mice PMID:23462797
  7. Suggest role for ependymal CCK-1 receptors in infant satiety-controlling mechanisms. PMID:23266937
  8. CCK-1 and -2 receptors may function synergistically in single PaPo neurons and deletion of CCK-1 receptors may facilitate CCK-2 receptor signaling. PMID:23038256
  9. This study demonistrated that cholecystokinin-1 receptor relate to glucose homeostasis. PMID:21871472
  10. data show that hyperphagia in CCKR/ mice ingesting HF diet is reversed by blockade of the ghrelin receptor. PMID:21277881
  11. activation of neurons in the nucleus of the solitary tract following administration of T2R agonists to the GI tract involves CCK(1) and Y(2) receptors located on vagal afferent terminals in the gut wall [CCK1R] PMID:18003792
  12. CCK-A receptor is important for pancreatic exocrine secretion but not essential for maintaining glucose concentration and pancreatic growth in mice PMID:11893936
  13. Anxiety-related behaviors in cholecystokinin-A, B, and AB receptor gene knockout mice in the plus-maze. PMID:12459512
  14. Gallstone formation was enhanced in CCK-AR gene knockout mice. PMID:12572876
  15. Deteriorated gallbladder contraction due to a lack of CCK-AR favored gallstone formation after the middle age of life. PMID:14627338
  16. Differential roles for cholecystokinin a receptors in energy balance in rats and mice. PMID:15123537
  17. Mice without CCK-AR showed larger hysteresis than mice with CCK-AR. PMID:15178543
  18. CCKAR is involved in CCK-8S-induced depolarization of orexin neurons. PMID:16093397
  19. MEKK1 probably activates a transcriptional partner of c-Jun whose activity is maintained or increased in the presence of the rat cholecystokinin 1 receptor but repressed in the presence of the mouse cholecystokinin 1 receptor. PMID:16491099
  20. CCK-AR(-/-)BR(-/-) mice showed lower food intake as well as lower response to exogenous ghrelin, and a lower plasma ghrelin level after fasting, though which receptor is more important is unknown. PMID:17134539
  21. Role for apo A-IV and CCK(1)R in PYY(3-36)-induced activation of vagal afferent pathway and inhibition of gastric emptying, but this is likely not pathway mediating effects of PYY(3-36) on food intake. PMID:17641001
  22. CCK-AR is an ERalpha downstream gene in the pituitary. CCK-AR may play role in the estrogen sensitization of the pituitary response to GnRH. PMID:18000302
  23. These results suggest that the CCK(1)R is involved in regulating caloric intake on a meal to meal basis, but that other factors are responsible for regulation of daily food intake. PMID:18023701
  24. data indicate a novel function of CCK-A receptors in the nonimage-forming photoreception presumably via amacrine cell-mediated signal transduction pathways. PMID:18073333
  25. Mice lacking CCK1Rs have fewer proliferating cells and neuroblasts than normal and a shortage of interneurons in the OB. PMID:18305161
  26. CCK-2R is necessary to respond to carbachol as well as to produce the maximal acid secretion, while the role of CCK-1R in acid secretion is less important PMID:19340558

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Database Links

UNIGENE: Mm.3521

KEGG: mmu:12425

STRING: 10090.ENSMUSP00000031093

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products