MDVVDSLLMNGSNITPPCELGLENETLFCLDQPQPSKEWQSAVQILLYSFIFLLSVLGNT LVITVLIRNKRMRTVTNIFLLSLAVSDLMLCLFCMPFNLIPNLLKDFIFGSAVCKTTTYF MGTSVSVSTFNLVAISLERYGAICRPLQSRVWQTKSHALKVIAATWCLSFTIMTPYPIYS NLVPFTKNNNQTANMCRFLLPSDAMQQSWQTFLLLILFLIPGVVMVVAYGLISLELYQGI KFDASQKKSAKEKRLSSGGGGGGGSSSSRYEDSDGCYLQKSRPPRKLELQQLSTSSSGGR INRIRSSGSAANLIAKKRVIRMLIVIVVLFFLCWMPIFSANAWRAYDTVSAEKHLSGTPI SFILLLSYTSSCVNPIIYCFMNKRFRLGFMATFPCCPNPGPTGVRGEVGEEEDGRTIRAS LSRYSYSHMSTSAPPH
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Receptor for cholecystokinin. Mediates pancreatic growth and enzyme secretion, smooth muscle contraction of the gall bladder and stomach. Has a 1000-fold higher affinity for CCK rather than for gastrin. It modulates feeding and dopamine-induced behavior in the central and peripheral nervous system. This receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system.
Gene References into Functions
The studies establish chronic pancreatitis as an IL-33-dependent inflammation resulting from synergistic interactions between the NOD1 and CCKR signaling pathways.PMID:26813347
There is functional synergy between cholecystokinin receptors CCKAR and CCKBR in mammalian brain development.PMID:25875176
mice lacking CCK receptors exhibited a functional shift from the gastrin-CCK pathways to the neuronal pathway in control of the ECL cells and eventually the acid secretionPMID:25160855
cellular and subcellular localization of cholecystokinin (CCK)-1 receptors in the pancreas, gallbladder, and stomachPMID:25249350
CCK-8S increases [Ca(2+)]i in gastric antral interstitial cells of Cajal via the CCK(1) receptorPMID:23326123
CCK1 receptor activation does not have a greater effect combination with upregulated leptin signalling in high-fat-fed micePMID:23462797
Suggest role for ependymal CCK-1 receptors in infant satiety-controlling mechanisms.PMID:23266937
CCK-1 and -2 receptors may function synergistically in single PaPo neurons and deletion of CCK-1 receptors may facilitate CCK-2 receptor signaling.PMID:23038256
This study demonistrated that cholecystokinin-1 receptor relate to glucose homeostasis.PMID:21871472
data show that hyperphagia in CCKR/ mice ingesting HF diet is reversed by blockade of the ghrelin receptor.PMID:21277881
activation of neurons in the nucleus of the solitary tract following administration of T2R agonists to the GI tract involves CCK(1) and Y(2) receptors located on vagal afferent terminals in the gut wall [CCK1R]PMID:18003792
CCK-A receptor is important for pancreatic exocrine secretion but not essential for maintaining glucose concentration and pancreatic growth in micePMID:11893936
Anxiety-related behaviors in cholecystokinin-A, B, and AB receptor gene knockout mice in the plus-maze.PMID:12459512
Gallstone formation was enhanced in CCK-AR gene knockout mice.PMID:12572876
Deteriorated gallbladder contraction due to a lack of CCK-AR favored gallstone formation after the middle age of life.PMID:14627338
Differential roles for cholecystokinin a receptors in energy balance in rats and mice.PMID:15123537
Mice without CCK-AR showed larger hysteresis than mice with CCK-AR.PMID:15178543
CCKAR is involved in CCK-8S-induced depolarization of orexin neurons.PMID:16093397
MEKK1 probably activates a transcriptional partner of c-Jun whose activity is maintained or increased in the presence of the rat cholecystokinin 1 receptor but repressed in the presence of the mouse cholecystokinin 1 receptor.PMID:16491099
CCK-AR(-/-)BR(-/-) mice showed lower food intake as well as lower response to exogenous ghrelin, and a lower plasma ghrelin level after fasting, though which receptor is more important is unknown.PMID:17134539
Role for apo A-IV and CCK(1)R in PYY(3-36)-induced activation of vagal afferent pathway and inhibition of gastric emptying, but this is likely not pathway mediating effects of PYY(3-36) on food intake.PMID:17641001
CCK-AR is an ERalpha downstream gene in the pituitary. CCK-AR may play role in the estrogen sensitization of the pituitary response to GnRH.PMID:18000302
These results suggest that the CCK(1)R is involved in regulating caloric intake on a meal to meal basis, but that other factors are responsible for regulation of daily food intake.PMID:18023701
data indicate a novel function of CCK-A receptors in the nonimage-forming photoreception presumably via amacrine cell-mediated signal transduction pathways.PMID:18073333
Mice lacking CCK1Rs have fewer proliferating cells and neuroblasts than normal and a shortage of interneurons in the OB.PMID:18305161
CCK-2R is necessary to respond to carbachol as well as to produce the maximal acid secretion, while the role of CCK-1R in acid secretion is less importantPMID:19340558