MLLAAVSLGLLLLAFLLLLRHLGWGLVAIGWFEFVQQPVHNLLMGGTKEQRILRHVQQHAKPGDPQSVLEAIDTYCSEKEWAMNVGDAKGQIMDAVIREYRPSLVLELGAYCGYSAVRMARLLPPGARLLTMEINPDYAAITQQMLDFAGLQDKVSILIGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAVYQGPGSSPVKS
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Catalyzes the O-methylation, and thereby the inactivation, of catecholamine neurotransmitters and catechol hormones. Also shortens the biological half-lives of certain neuroactive drugs, like L-DOPA, alpha-methyl DOPA and isoproterenol.
Gene References into Functions
Miroestrol restored uterine COMT expression in beta-naphthoflavone-treated mice.PMID:26893163
This study report that genetically driven reduction in COMT enzyme activity increased cortical thickness in the prefrontal cortex (PFC) and postero-parieto-temporal cortex of male, but not female adult mice.PMID:24658585
COMT expression in the hippocampus was significantly reduced by high E2 replacement, implying increased catecholamine levels in the hippocampus of high E2 mice.PMID:25555360
COMT overexpressing mice display an increase in dopamine release capacity in the striatum, suggesting increased COMT activity may affect dopamine signaling by enhancing synaptic clearance in the cortex and changes in striatal presynaptic dopamine functionPMID:24639487
These data confirm at the level of mouse working memory and human working memory-associated physiology a genetic interaction between COMT and DTNBP1.PMID:24145376
The results of this study suggest that individual differences in COMT activity do not affect primary reinforcing effects of cocaine in mice.PMID:23011431
Inhibition of COMT via serotonin binding contributes to pain hypersensitivity.PMID:22500608
COMT knockout mice were more impulsive compared with wild-type littermates.PMID:23169629
Data show that in male catechol-O-methyltransferase COMT(-/-)-mice, the total number of T-, and B-lymphocytes from spleen increased but the T-cell proliferative response decreased.PMID:22658921
decreased COMT activity was associated with some changes in feeding microstructure in rats and micePMID:21851556
This study demonistrated that COMT deletion with elevated anxiety in females and suggest that this may be related to a heightened neuroendocrine response to acute stress in COMT KO mice.PMID:22192380
COMT deficiency in virgin female mice with intact endogenous production of estradiol results in relative protection against atherosclerosisPMID:22009725
In catechol-O-methyltransferase knock-out mice administration of tetrahydrocannabinol induced a larger increase in exploratory behavior and greater impairment in spatial working memory.PMID:20631688
Strains with the SINE haplotype (+SINE) have greater Comt1 enzymatic activity. +SINE mice also exhibit behavioral differences in anxiety assays and decreased pain sensitivity.PMID:20659173
Findings show that Comt1(B2i) (a B2 SINE insertion) results in a relatively modest difference in Comt1 expression and enzyme activity which has a demonstrable behavioral effect across a variety of outbred genetic backgrounds.PMID:20618449
A lack of S-COMT has a notable brain-area and sex-dependent effect on the O-methylation of dopamine and 3,4-dihydroxyphenylacetic acid in the mouse brain and induces subtle change in social behavior and nociceptionPMID:20617305
In the mouse, the prefrontal cortex COMT contributes about one half of the total dopamine clearance.PMID:20626558
Both soluble COMT and membrane-bound COMT forms were abundantly found in microglial cells and intestinal macrophages, but also in astroglial cells. COMT was also present in some neuronal cells and nuclear COMT is not visible in S-COMT deficient mice.PMID:20374420
Findings in mice with reduced or absent COMT activity reveal its important role in the dopamine-mediated regulation of renal sodium excretion.PMID:12188925
First demonstration of the significant contribution of catechol-O-methyltransferase in modulating the dynamics of dopamine overflow in the prefrontal cortex.PMID:17881525
pregnant mice deficient in catechol-O-methyltransferase (COMT) show a pre-eclampsia-like phenotype resulting from an absence of 2-methoxyoestradiolPMID:18469803
catechol-O-methyltransferase and neuregulin-1 may influence, respectively, primarily cognitive and social endophenotypes of the overall schizophrenia syndrome.PMID:18674597
Disruption of Comt gene influenced ethanol consumption in a gender-dependent manner in mice, supporting the hypothesis that low catechol-O-methyltransferase activity is one of the predisposing factors for high alcohol consumption in males.PMID:18684228
Show
More
Hide
All
Subcellular Location
[Isoform Soluble]: Cytoplasm.; [Isoform Membrane-bound]: Cell membrane; Single-pass type II membrane protein; Extracellular side.
Protein Families
Class I-like SAM-binding methyltransferase superfamily, Cation-dependent O-methyltransferase family