AEAHQAVAFQFTVTPDGIDLRLSHEALKQICLSGLHSWKKKFIRFKNGIITGVFPASPSS WLIVVVGVISSMHTKVDPSLGMIAKINRTLDTTGRMSSQTKNIVSGVLFGTGLWVAIIMT MRYSLKVLLSYHGWMFAEHGKMSRSTRIWMAMVKVFSGRKPMLYSFQTSLPRLPVPAVKD TVSRYLESVRPLMKEGDFQRMTALAQDFAVNLGPKLQWYLKLKSWWATNYVSDWWEEYIY LRGRGPIMVNSNYYAMEMLYITPTHIQAARAGNTIHAILLYRRTVDREELKPIRLLGSTI PLCSAQWERLFNTSRIPGEETDTIQHVKDSRHIVVYHRGRYFKVWLYHDGRLLRPRELEQ QMQQILDDTSEPQPGEAKLAALTAADRVPWAKCRQTYFARGKNKQSLDAVEKAAFFVTLD ESEQGYREEDPEASIDSYAKSLLHGRCFDRWFDKSITFVVFKNSKIGINAEHSWADAPIV GHLWEYVMATDVFQLGYSEDGHCKGDKNPNIPKPTRLQWDIPGECQEVIETSLSSASFLA NDVDLHSFPFDTFGKGLIKKCRTSPDAFIQLALQLAHYKDMGKFCLTYEASMTRLFREGR TETVRSCTTESCNFVLAMMDPTTTAEQRFKLFKIACEKHQHLYRLAMTGAGIDRHLFCLY VVSKYLAVDSPFLKEVLSEPWRLSTSQTPQQQVELFDFEKYPDYVSCGGGFGPVADDGYG VSYIIVGENFIHFHISSKFSSPETDSHRFGKHLRQAMMDIITLFGLTANSKK
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Catalyzes the transfer of the acyl group of long-chain fatty acid-CoA conjugates onto carnitine, an essential step for the mitochondrial uptake of long-chain fatty acids and their subsequent beta-oxidation in the mitochondrion. Plays an important role in hepatic triglyceride metabolism.
Gene References into Functions
Alogliptin increased hepatic mRNA expression levels associated with fatty acid oxidation. In addition, the results of the present study suggested that ALO promotes CPT1a expression via Thr172 phosphorylation of AMPKalpha.PMID:29512720
Furthermore, given the already low abundance of Cpt1b in white adipose tissue, it is unlikely that decreases in its expression can quantitatively decrease whole body energy expenditure enough to contribute to an obese phenotype.PMID:28330968
beneficial effects of muscle CPT1mt expression suggest that a direct modulation of the malonyl-CoA/CPT1 partnership in skeletal muscle could represent a potential strategy to prevent obesity-induced insulin resistancePMID:27507552
The data suggest that AMPK is not required for the regulation of the intermediate filament interaction with CPT-I during exercise.PMID:27941154
These results suggest that n-3 polyunsaturated fatty acids could improve lipid oxidation-related enzymes in liver subjected to hemorrhagic shock/resuscitation.PMID:27110821
these results demonstrated that L-carnitine ameliorated liver inflammation and serum pro-inflammatory markers in cancer cachexia through regulating CPT I-dependent PPARg signalingPMID:26647854
Data show that peroxisome-proliferator-activated receptor beta/delta (PPARbeta/delta) activation restored the lipid-induced endothelial dysfunction by up-regulation of carnitine palmitoyltransferase)-1 (CPT-1).PMID:26253087
Our results indicated that exercise-induced CPT1b expression was at least in part mediated by HDAC5/MEF2A interaction.PMID:25213552
Data indicate that muscle mutated carnitine palmitoyltransferase 1 (CPT1mt) expression enhanced mitochondrial fatty acid oxidation (mFAO) capacity.PMID:25713059
Potential epigenetic mechanisms underlying transcriptional regulation of Cpt1alpha in hepatic steatosis occur in response to binge ethanol administration.PMID:23905631
an environment-dependent structural switch underlies the regulation of carnitine palmitoyltransferase 1APMID:21990363
miR-370 acting via miR-122 may have a causative role in the accumulation of hepatic triglycerides by modulating initially the expression of SREBP-1c, DGAT2, and Cpt1alpha.PMID:20124555
Results show that CREB and HNF4alpha bind the CPT promoter, that PGC-1 is involved in liver carnitine palmitoyltransferase I (CPT) gene activation by cylic AMP, and that PGC-1 acts to coordinate the process of metabolic adaptation in the liver.PMID:12107181
role of thyroid hormone response unit formed between the promoter and first intron in mediating liver-specific induction by thyroid hormonePMID:12493735
Malonyl-CoA/CPTI interaction is a component of a metabolic signaling network that controls insulin secretion.PMID:15677504
modulation of CPT1A expression by PI3K-dependent signaling is the major mechanism by which cells suppress beta-oxidation during anabolic growthPMID:17030509
These results suggested that astaxanthin promoted lipid metabolism rather than glucose utilization during exercise via CPT I activation, which led to improvement of endurance and efficient reduction of adipose tissue with training.PMID:18082622