Orai1; Cracm1; Tmem142a; Calcium release-activated calcium channel protein 1; Protein orai-1; Transmembrane protein 142A
Species
Mus musculus (Mouse)
Source
in vitro E.coli expression system
Expression Region
1-304
Target Protein Sequence
MHPEPAPPPSHSNPELPVSGGSSTSGSRRSRRRSGDGEPSGAPPLPPPPPAVSYPDWIGQ SYSEVMSLNEHSMQALSWRKLYLSRAKLKASSRTSALLSGFAMVAMVEVQLDTDHDYPPG LLIVFSACTTVLVAVHLFALMISTCILPNIEAVSNVHNLNSVKESPHERMHRHIELAWAF STVIGTLLFLAEVVLLCWVKFLPLKRQAGQPSPTKPPAESVIVANHSDSSGITPGEAAAI ASTAIMVPCGLVFIVFAVHFYRSLVSHKTDRQFQELNELAEFARLQDQLDHRGDHSLTPG THYA
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Ca(2+) release-activated Ca(2+) (CRAC) channel subunit which mediates Ca(2+) influx following depletion of intracellular Ca(2+) stores and channel activation by the Ca(2+) sensor, STIM1. CRAC channels are the main pathway for Ca(2+) influx in T-cells and promote the immune response to pathogens by activating the transcription factor NFAT. Plays a prominent role in Ca(2+) influx at the basolateral membrane of mammary epithelial cells independently of the Ca(2+) content of endoplasmic reticulum or Golgi stores. May mediate transepithelial transport of large quantities of Ca(2+) for milk secretion.
Gene References into Functions
activation of TRPC1-based SOCs through a STIM1-activated PLCbeta1 pathway are likely to occur independently of Orai1 proteinsPMID:28301277
SGK1 influences migration of VSMC by transcriptional regulation of Ca2+ channel Orai1 expression, an effect requiring SGK1-dependent activation of transcription factor NF-B after arterial injury.PMID:28203685
the declined Orai1 expression, at least partly, contributes to the downregulated Ca(2+) entry during lymphocyte excitation, providing an important mechanism for T lymphocyte malfunction in diabetes.PMID:29654766
SOCE was largely diminished in cells where STIM1 and/or ORAI1 had been silenced by small interfering (si)RNA. We conclude that extracellular ATP activates SOCE in white adipocytes, an effect predominantly mediated by STIM1 and ORAI1.PMID:29335300
Study shows that STIM1 and ORAI1 promotes membrane ruffling by showing that phospho-STIM1 localizes at the leading edge of cells, and that both phospho-STIM1 and ORAI1 co-localize with cortactin.PMID:28341841
Results show that Orai1 binds to the PRY-SPRY region of MG53 and co-localizes with MG53 in the plasma membrane in skeletal muscle which enhances extracellular Ca2+ entry via Orai1 by store-operated Ca(2+) entry mechanism.PMID:27841305
Silencing of beta 1 integrin gene regulates the gene expression of storeoperated Ca2+ entry (SOCE)-associated genes (STIM1, ORAI1 and TRPC1).PMID:28656279
Our study demonstrates that Orai1-Ca(2+)-calcineurin-NFATc4 signaling is an essential inflammatory pathway required for TNFalpha-induced endothelial cell activation and vascular inflammation. Therefore, Orai1 may be a potential therapeutic target for treatment of inflammatory diseases.PMID:29223400
Store-operated calcium entry via Orai1 in mesangial cells negatively regulates the TGF-beta1/Smad3 signaling pathway.PMID:28637791
Orai1 enhances muscle endurance by promoting fatigue-resistant type I fiber contentPMID:27587568
Mouse embryos deficient in Orai1, Klf2, or Klf4 showed a significantly reduced lymphatic density and impaired lymphatic development.PMID:28167653
Store operated calcium entry negatively regulates the Smad1 signaling pathway and inhibits Col IV protein production in glomerular mesangial cells.PMID:28298362
F. vulgare fruits extract and its hexane fraction strongly blocked ORAI1 currents and tyrosinase activity and significantly inhibited UV-induced melanogenesisPMID:27712859
mice lacking acinar Orai1 exhibited intestinal bacterial outgrowth and dysbiosis, ultimately causing systemic translocation, inflammation, and death.PMID:28273482
these data indicate for the first time a functional interaction between Orai1, TRPC1, and CaV1.2 channels in Vascular Smooth Muscle Cells, confirming that upon agonist stimulation, vessel contraction involves Ca(2+) entry due to co-activation of Orai1- and TRPC1-dependent store-operated Ca(2+) channels and L-type Ca(2+) channels.PMID:27535226
reveal that Orai1(-/-) male mice are sterile and have severe defects in spermatogenesis, with prominent deficiencies in mid- to late-stage elongating spermatid developmentPMID:26969191
In Dicer-deficient mice Orai1 was down-regulated at mRNA and protein level in CD4+ T cells.PMID:27607422
results identified the ORAI-NOX2 feedback loop as a determinant of monocyte immune responses.PMID:26956485
Orai1-dependent Ca(2+) entry promotes atherogenesis possibly by promoting foam cell formation and vascular inflammation, rendering orai1 Ca(2+) channel a potential therapeutic target against atherosclerosis.PMID:26916730
strong expression during the ameloblast secretory stagePMID:26178077
alternative translation initiation of the Orai1 message produces at least three types of Ca(2+) channels with distinct signaling and regulatory properties.PMID:26221052
Orai1 and STIM1 have roles in inhibiting matrix protein expressionPMID:25788524
SOCE blockers or ablation of STIM1, STIM2, or Orai1 severely impaired nucleotide-induced migration and phagocytosis in microglia.PMID:25471906
Our data establish Orai1 as key signal mediator of C5aR activation, contributing to inflammationPMID:25912155
Orai1 store-operated calcium channels have an essential role in lactationPMID:25902527
TRPC6 activity can occur independently of the physical interaction with Orai1PMID:24520961
Data show that increased activity of STIM1-Orai1 complex inducing enhanced Ca(2+) influx is a disease determinant in muscular dystrophy.PMID:24556214
STIM1, STIM2, and CRAC channel function play distinct but synergistic roles in CD4+ and CD8+ T cells during antiviral immunityPMID:25157823
The calcium release-activated calcium channel Orai1 represents a crucial component in hypertrophic compensation and the development of dilated cardiomyopathyPMID:24135962
Data indicate that STIM1 is involved in both early neural differentiation of ES cells and survival of early differentiated ES cells independent of Orai1-mediated SOCE.PMID:24424349
These studies indicate a critical role for Orai1-mediated SOCE in lacrimal gland signalling and function.PMID:24297846
Store-operated Ca(2+) entry was lost in embryonic and adult mouse neural progenitor cells from transgenic mice lacking Orai1 or STIM1 and in knock-in mice expressing the loss-of-function Orai1 mutant R93W.PMID:24990931
Inhibition of Orai1 induces skin atrophy and decreases epidermal proliferation in micePMID:24317393
Lactation is associated with the enhancement of basal Ca2+ influx that appears to occur through the calcium channel Orai1.PMID:24359162
The AMPK alpha1 sensitive Ca2+ entry is abrogated by Orai1 blocker 2-APB.PMID:24080823
T cells expressing ORAI1-DN lacked TCR activation induced [Ca(2+)]i elevation, yet arrested motility similar to control T cells in vitro.PMID:23939929
Orai1 protein is mainly confined to the basal layer of epidermis where it plays a critical role to control keratinocyte proliferation and polarized motility.PMID:24277812
Data indicate that the Ca(2+) release-activated Ca(2+) channels (CRAC) blocker GSK-7975A inhibited store-operated Ca(2+) entry in a concentration-dependent manner.PMID:23878235
ORAI1 is the main calcium entry mechanism during oxidative glutamate toxicity, suggesting that SOCE inhibition might be a valuable tool in the treatment of diseases associated with increased oxidative stress.PMID:23348584
Our data indicates that upregulation of the Orai1-mediated SOCE pathway and an overloaded SR Ca(2+) store contributes to the disrupted Ca(2+) homeostasis in mdx muscles and is linked to elevated proteolytic activityPMID:23185465
Orai1 function is essential for T cell homing to lymph nodes.PMID:23455504
The Orai1-mediated Store-operated Ca(2+) entry plays a crucial role in the mineralization of osteoblasts by regulating expression of bone matrix protein.PMID:23122304
Orai-1 protein level is greatly upregulated in airway smooth muscle cells from asthmatic mice.PMID:23014880
The data provided direct evidence that TRPC1 and Orai1 channels mediate capacitative calcium entry through activation of STIM1 in acute hypoxic mouse pulmonary arterial smooth muscle cells.PMID:23034388
Micro-CT showed reduced cortical ossification and thinned trabeculae in Orai1(-/-) animals compared with controls; bone deposition was markedly decreased in the knockout mice. This suggests a previously unrecognized role for Orai1 within osteoblasts.PMID:22546867
intracellular alkalinization inhibits SERCA activity, activating store-operated channels (SOCs) of Orai1 and Stim1, leading to increased Ca(2+) influxPMID:22384096
ORAI1 is involved in the Ca(2+) entry pathway in the mature oocyte.PMID:22053056
Downregulation of Orai1 expression in the airway, adminestering recombinant lentivirus vectors that encoded shRNA against ORAI1, alleviated symptoms of allergic rhinitis in mice.PMID:22170034
Hypertrophy in skeletal myotubes induced by junctophilin-2 mutant, Y141H, involves an increase in store-operated Ca2+ entry via Orai1.PMID:22389502
Results indicate that Orai1 plays a critical role in the differentiation and function of osteoclasts, by regulating activation of the transcription factor NFATc1.PMID:22198385