APTNLTDSGLDQEPFLYLVGRKKLLDAQYKCYDRIHQLPSYEGEGLYCNRTWDGWMCWDD TPAGATAYQHCPDYFPDFDTAEKVSKYCDENGEWFRHPDSNRTWSNYTLCNAFTSEKLQN AYVLYYLALVGHSLSIAALVASMLIFWIFKNLSCQRVTLHKHMFLTYILNSIIIIIHLVE VVPNGDLVRRDPMHIFHHNTHMWTMQWELSPPLPLCAHEGKMDPHASEVISCKVLHFLHQ YMMSCNYFWMLCEGIYLHTLIVMAVFTDEQRLRWYYLLGWGFPIVPTIIHAITRALYYND NCWLSAETHLLYIIHGPVMVALVVNFFFLLNIVRVLVTKMRQTHEAESYMYLKAVKATMV LVPLLGIQFVVFPWRPSNKVLGKIYDYLMHSLIHFQGFFVATIYCFCNHEVQVTLKRQWT QFKIQWSQRWGRRRPTNRVVSAPRAVAFAEPDGLPIYICHQEPRNPPISNNEGEESTEMI PMNVIQQDASA
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
This is a receptor for calcitonin. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. The calcitonin receptor is thought to couple to the heterotrimeric guanosine triphosphate-binding protein that is sensitive to cholera toxin.
Gene References into Functions
Endosomal signaling of the CLR mediates pain transmission.PMID:29087309
calcitonin receptor is expressed in the suprachiasmatic nucleus and mediates body temperature fluctuations during the active phase in mice.PMID:29440246
Calcr knockout resulted in abnormal quiescent state of muscle stem cells, reduction of their pool apoptosis and relocation from the MSC niche.PMID:26440893
data suggest that Clr-b modulation is a conserved innate host cell response to virus infection that is subverted by multiple CMV immune evasion strategies.PMID:26044139
upregulated in synovial tissue of osteoarthritic mice by macrophage-derived IL-1 betaPMID:26400621
protects the maternal skeleton during lactation by a direct action on osteocytes to inhibit osteolysisPMID:26135836
Together, these data indicate that signaling through RAMP1 and CLR plays a role in mediating asthma pathologyPMID:25010197
The relevance of the OPG/RANK/RANKL system in the particle-induced osteolysis process, was investigated.PMID:25486133
Nkrp1-Clr gene cluster appears to evolve more slowly relative to the related Ly49 cluster, and likely regulates innate immunosurveillance in a tissue-specific mannerPMID:23226525
Odz4 is expressed in quiescent satellite cells, like calcitonin receptor, but the timing of the reappearance of these genes is different during regeneration.PMID:22562803
The perinatal expression of CTR within the ENS suggests that the calcitonin/CTR system may have a role in the maturation of enteric neuronsPMID:22271140
CGRP-receptor component protein has been found to interact only with calcitonin-like receptor and represents a novel neuroendocrine regulatory step in calcitonin gene-related peptide signaling.PMID:22315449
CTR protects against hypercalcemia predominantly via its inhibitory action on osteoclasts.PMID:20850575
Data show that amylin inactivation leads to a low bone mass due to an increase in bone resorption, whereas bone formation is unaffected.PMID:14970190
Calcr is imprinted in a tissue-specific manner, with a predominant expression from the maternal allele in the brainPMID:12730726
Data show that mutation of calcitonin-like receptor did not affect its expression at the cell surface, but impaired the calcitonin gene-related peptide and adrenomedullin receptor function in the presence of receptor-activity-modifying proteins 1 and 2.PMID:15194494
CTR is not only down regulated by signaling through the CTR but also by the peptides signaling through calcitonin receptor-like receptor, and receptor activity modifying proteinsPMID:18384073
These data provide strong evidence for a biological role of the CTR in regulating calcium homeostasis in states of calcium stress.PMID:18627265