Recombinant Mouse Calcitonin receptor (Calcr)

Code: CSB-CF004439MO
Size:
20μg
20μg100μg
US$6168
Quantity:
Express system: in vitro E.coli expression system
Species: Mus musculus (Mouse)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
Calcr
Uniprot NO.
Alternative Names
Calcr; Calcitonin receptor; CT-R
Species
Mus musculus (Mouse)
Source
in vitro E.coli expression system
Expression Region
25-515
Target Protein Sequence
APTNLTDSGLDQEPFLYLVGRKKLLDAQYKCYDRIHQLPSYEGEGLYCNRTWDGWMCWDD TPAGATAYQHCPDYFPDFDTAEKVSKYCDENGEWFRHPDSNRTWSNYTLCNAFTSEKLQN AYVLYYLALVGHSLSIAALVASMLIFWIFKNLSCQRVTLHKHMFLTYILNSIIIIIHLVE VVPNGDLVRRDPMHIFHHNTHMWTMQWELSPPLPLCAHEGKMDPHASEVISCKVLHFLHQ YMMSCNYFWMLCEGIYLHTLIVMAVFTDEQRLRWYYLLGWGFPIVPTIIHAITRALYYND NCWLSAETHLLYIIHGPVMVALVVNFFFLLNIVRVLVTKMRQTHEAESYMYLKAVKATMV LVPLLGIQFVVFPWRPSNKVLGKIYDYLMHSLIHFQGFFVATIYCFCNHEVQVTLKRQWT QFKIQWSQRWGRRRPTNRVVSAPRAVAFAEPDGLPIYICHQEPRNPPISNNEGEESTEMI PMNVIQQDASA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
This is a receptor for calcitonin. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. The calcitonin receptor is thought to couple to the heterotrimeric guanosine triphosphate-binding protein that is sensitive to cholera toxin.
Gene References into Functions
  1. Endosomal signaling of the CLR mediates pain transmission. PMID:29087309
  2. calcitonin receptor is expressed in the suprachiasmatic nucleus and mediates body temperature fluctuations during the active phase in mice. PMID:29440246
  3. Calcr knockout resulted in abnormal quiescent state of muscle stem cells, reduction of their pool apoptosis and relocation from the MSC niche. PMID:26440893
  4. data suggest that Clr-b modulation is a conserved innate host cell response to virus infection that is subverted by multiple CMV immune evasion strategies. PMID:26044139
  5. upregulated in synovial tissue of osteoarthritic mice by macrophage-derived IL-1 beta PMID:26400621
  6. protects the maternal skeleton during lactation by a direct action on osteocytes to inhibit osteolysis PMID:26135836
  7. Together, these data indicate that signaling through RAMP1 and CLR plays a role in mediating asthma pathology PMID:25010197
  8. The relevance of the OPG/RANK/RANKL system in the particle-induced osteolysis process, was investigated. PMID:25486133
  9. Nkrp1-Clr gene cluster appears to evolve more slowly relative to the related Ly49 cluster, and likely regulates innate immunosurveillance in a tissue-specific manner PMID:23226525
  10. Odz4 is expressed in quiescent satellite cells, like calcitonin receptor, but the timing of the reappearance of these genes is different during regeneration. PMID:22562803
  11. The perinatal expression of CTR within the ENS suggests that the calcitonin/CTR system may have a role in the maturation of enteric neurons PMID:22271140
  12. CGRP-receptor component protein has been found to interact only with calcitonin-like receptor and represents a novel neuroendocrine regulatory step in calcitonin gene-related peptide signaling. PMID:22315449
  13. CTR protects against hypercalcemia predominantly via its inhibitory action on osteoclasts. PMID:20850575
  14. Data show that amylin inactivation leads to a low bone mass due to an increase in bone resorption, whereas bone formation is unaffected. PMID:14970190
  15. Calcr is imprinted in a tissue-specific manner, with a predominant expression from the maternal allele in the brain PMID:12730726
  16. Data show that mutation of calcitonin-like receptor did not affect its expression at the cell surface, but impaired the calcitonin gene-related peptide and adrenomedullin receptor function in the presence of receptor-activity-modifying proteins 1 and 2. PMID:15194494
  17. CTR is not only down regulated by signaling through the CTR but also by the peptides signaling through calcitonin receptor-like receptor, and receptor activity modifying proteins PMID:18384073
  18. These data provide strong evidence for a biological role of the CTR in regulating calcium homeostasis in states of calcium stress. PMID:18627265

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 2 family
Database Links

UNIGENE: Mm.4642

KEGG: mmu:12311

STRING: 10090.ENSMUSP00000075070

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products