Cd70; Cd27l; Cd27lg; Tnfsf7; CD70 antigen; CD27 ligand; CD27-L; Tumor necrosis factor ligand superfamily member 7; CD antigen CD70
Species
Mus musculus (Mouse)
Source
in vitro E.coli expression system
Expression Region
1-195
Target Protein Sequence
MPEEGRPCPWVRWSGTAFQRQWPWLLLVVFITVFCCWFHCSGLLSKQQQRLLEHPEPHTAELQLNLTVPRKDPTLRWGAGPALGRSFTHGPELEEGHLRIHQDGLYRLHIQVTLANCSSPGSTLQHRATLAVGICSPAAHGISLLRGRFGQDCTVALQRLTYLVHGDVLCTNLTLPLLPSRNADETFFGVQWICP
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Cytokine which is the ligand for CD27. The CD70-CD27 pathway plays an important role in the generation and maintenance of T cell immunity, in particular during antiviral responses. Upon CD27 binding, induces the proliferation of costimulated T-cells and enhances the generation of cytolytic T-cells.
Gene References into Functions
CD70 mitigates atherosclerosis at least in part by modulating macrophage function.PMID:27786334
these findings demonstrate for the first time, to our knowledge, that T cell-derived CD70 plays a novel immune checkpoint role in inhibiting inflammatory T cell responsesPMID:29046346
findings demonstrate that host CD70 serves as a unique negative regulator of allogeneic T cell response by contributing to donor T cell apoptosis and inhibiting expansion of donor effector T cells.PMID:28550198
Mice lacking CD70 did not accumulate memory T cells and did not develop hypertension.PMID:26988069
find that while stimulation of CD27 in isolation drives weak Eomesodermin(hi) T-bet(lo) CD8(+) T-cell responses to OVA immunizationPMID:26461455
Data show that although CD70 is required for the activation of the antiviral adaptive response, it has a regulatory role in early cytokine responses to viruses such as MCMV, possibly through maintenance of Treg survival and function.PMID:24913981
the ability of CD70 to trigger costimulation is self-regulated when it binds its complementary receptor.PMID:23913967
Expression of CD70 by B cells aggravates experimental autoimmune encephalomyelitis by reducing the number of regulatory T cells.PMID:23137837
CD70-deficient mice infected with lymphocytic choriomeningitis virus produced only half as many T8 cells. Viral clearance was substantially delayed. CD70-mediated costimulation is not required for secondary or T4 responses.PMID:23269247
Although CD70 is required for dendritic cell-mediated delay of T cell tolerance induction, CD80 and CD86 are necessary for refunctionalizing the tolerized T cells in prostate tumor tissuePMID:22798683
CD70-driven costimulation induces survival or Fas-mediated apoptosis of T cells depending on antigenic load.PMID:22450812
Adoptively transferred CD70-specific T cells induced sustained regression of established murine xenografts.PMID:21304103
In this review, CD27 and CD70 constitute a unique ligand/receptor pair which can activate innate and adaptive immunity as well as regulate immunity versus tolerance.PMID:20699361
We show here that sterile chronic immune activation driven by enhanced expression of CD70 is in fact highly protective against atherosclerosis.PMID:20505312
Data show that costimulation by CD70 or OX40L seems to be necessary for primary CD4(+) T cell responses to multiple forms of immunization.PMID:20639485
These data support the hypothesis that induction of CD70 expression on dendritic cells (DC) after an encounter with activated CD4(+) T cells is a major component of CD4(+) T cell-mediated licensing of DC.PMID:19952354
Data indicate that, while CD70 plasma membrane expression is not detectable in resting T and B cells, low levels are induced following influenza infection in lung-infiltrating activated T cells and T and B cells in draining lymph nodes.PMID:12496380
Administration of antigenic peptide and a soluble recombinant form of CD70 results in a massive (>300-fold) expansion of antigen-specific CD8+ T cells in vivo, due to the enhanced proliferation and survival of activated T cells.PMID:15128787
CD70 expression on antigen presenting cells plays a key role in CD40-dependent CD8 T cell responses; CD70 blockade inhibits CD40-mediated clonal expansion of CD8 T cells and reduces the number of memory CD8 T cells generated.PMID:15557144
Expression of CD70 on dendritic cells is an important determinant for helper-dependence of primary CD8+ T cell expansion.PMID:15634890
The novel CD70-CD27 pathway plays a critical role in alloimmune responses independently of the CD28-B7 costimulatory pathway.PMID:15661893
CD70-positive antigen-presenting cells control the proliferation and differentiation of T cells in the intestinal mucosa.PMID:15937486
ectopic expression of CD70 in mouse glioma cells enhances apoptosis of T, B and NK cells in coculture, but nevertheless promotes glioma cell lysis by NK cells in vitroPMID:16217761
innate and adaptive (CD4+ T cells) arms of the immune system use a common signaling pathway in driving CD8+ T cell responses and suggest that expression of CD70 on dendritic cell (DC) represents the hallmark of conditioned DCPMID:16920932
CD70 expression on dendritic cells plays an important role in the priming of CD8-positive T cells by pathogens.PMID:17295392
CD70 is a decision maker for Th1 differentiation by CD205(+) dendritic cells.PMID:17438065
CD27-CD27L interactions are essential for developing a robust primary antiviral CD8-positive T cell immune response.PMID:18292513
injection of alpha-galactosylceramide triggers CD70 expression on splenic T cell zone dendritic cells and that this is dependent on CD40 signaling.PMID:18354184
the sole expression of CD70 by otherwise immature cDCs sufficed to convert CD8+ T cell tolerance into immunity, defining the importance of CD27-CD70 interactions at the interface between T cell and DC.PMID:19062317
The CD27-CD70 costimulatory pathway plays an important role in the development of experimental colitis; CD70 blockade leads directly to reduction in T cell numbers and thus reduces mucosal inflammation.PMID:19525396
CD27L requires trimer stabilization and oligomerizationPMID:19596991
endogenous IL-18 might facilitate stomach cancer cell immune escape by suppressing CD70 and increasing metastatic ability by upregulating CD44 and VEGFPMID:19638429
Show
More
Hide
All
Subcellular Location
Membrane; Single-pass type II membrane protein.
Protein Families
Tumor necrosis factor family
Tissue Specificity
Very low level of expression. Detected in splenocytes and thymocytes.