Cd27; Tnfrsf7; CD27 antigen; CD27L receptor; T-cell activation antigen CD27; Tumor necrosis factor receptor superfamily member 7; CD antigen CD27
Species
Mus musculus (Mouse)
Source
in vitro E.coli expression system
Expression Region
24-250
Target Protein Sequence
PNSCPDKHYWTGGGLCCRMCEPGTFFVKDCEQDRTAAQCDPCIPGTSFSPDYHTRPHCESCRHCNSGFLIRNCTVTANAECSCSKNWQCRDQECTECDPPLNPALTRQPSETPSPQPPPTHLPHGTEKPSWPLHRQLPNSTVYSQRSSHRPLCSSDCIRIFVTFSSMFLIFVLGAILFFHQRRNHGPNEDRQAVPEEPCPYSCPREEEGSAIPIQEDYRKPEPAFYP
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Receptor for CD70/CD27L. May play a role in survival of activated T-cells. May play a role in apoptosis through association with SIVA1.
Gene References into Functions
CD27 expression is upregulated in a subset of hematopoietic cluster cells, and CD27 marks hematopoietic stem cells (HSC), type II pre-HSCs, and progenitors with lymphoid potential within the cluster cells.PMID:28588017
CD70 reverse signaling enhances NK cell function and immunosurveillance in CD27-expressing B-cell malignancies.PMID:28495792
CD27-dependent CD8(+) T cell priming and differentiation are shaped by the efficiency of NK responses to virus infection.PMID:27798162
HSCs appear to maintain expression of CD27 after hematopoietic injury when Kit expression is downregulated.PMID:25892186
Mature CD27low NK cells promote allograft survival under costimulatory blockade conditions by regulating alloreactive memory CD8+ T-cell responses in T-bet dependent manner.PMID:25606781
identify an IL-17-dependent lymphoid/myeloid cross-talk involving CD27(-) gammadelta T cells and small peritoneal macrophages that promotes ovarian tumor cell growth and thus counteracts cancer immunosurveillancePMID:25114209
memory CD8 T cells, generated through priming with CD27 agonists, proliferated more extensively than did 4-1BB-generated memory cells, but these cells failed to persist.PMID:24860188
the central role played by CD27/70 during secondary CD8(+) T-cell activation to a peptide Ag, and identify sCD70 as an immunotherapeutic adjuvant for antitumor immunity.PMID:24002868
under conditions of constitutive CD70 expression reflecting chronic immune activation, the CD27/CD70 system inhibits OC differentiation and favors DC differentiationPMID:23832783
mTECs and DCs form dedicated niches in the thymic medulla, in which CD27-CD70 co-stimulation rescues developing Treg cells from apoptosis, subsequent to Foxp3 induction by TCR and CD28 signals.PMID:23547099
The CD27 and CD70 costimulatory pathway inhibits effector function of T helper 17 cells and attenuates associated autoimmunity.PMID:23159439
population of CD27(-) Th2 cells was significantly reduced by the anti-CD70 mAb treatmentPMID:22499851
The CD4+ T-cell help signal is transmitted from APC to CD8+ T-cells via CD27-CD70 interactions.PMID:22781761
These data indicate that CD27/OX40 can serve the central function as signal 3 mediators, independent of IFN or IL-12, for the generation of CD8(+) T cell immune memory.PMID:22178730
Data show that in a mouse model of chronic myelogenous leukemia, BCR/ABL+ leukemia stem and progenitor cells express CD27, and reveal a mechanism by which adaptive immunity contributes to leukemia progression.PMID:22232214
CD27 is dispensable for the development of functional NK cells. However, upon stimulation of NK cells, CD27 displays an important role in their activation and functionality.PMID:21283110
maintains clonally diverse CD8(+) T cell responses of low antigen affinity to protect against viral variantsPMID:21763160
Our findings suggest that antigen persistence may determine the opposing effects of CD27/CD70 signaling on CD8 T cell responses during acute and chronic lymphocytic choriomeningitis virus infection of mice.PMID:21507976
In this review, The CD27/CD70 axis has some unique properties that confer to it a crucial role as a regulator of immunity versus tolerance, favoring lymphocyte activation and survival and regulating immunity versus tolerance.PMID:20699361
CD27 costimulation is not critical for the development of asthma in an experimental disease modelPMID:20600327
With strongly replicating (i.e., virulent) vaccinia virus, the TNFR family costimulatory receptors OX40 and CD27 were engaged and promoted the generation of high numbers of memory CD8+ T cells, which protected against a lethal virus challenge.PMID:21183789
The PIQED region of the CD27 tail is involved in inhibition of terminal differentiation of B cells.PMID:20974987
CD27 signaling upregulates antiapoptotic Bcl-2 family member Bcl-xL and supports generation of the CD8+ effector T cell pool, not only by counteracting apoptosis via Bcl-2 family members but also by directing expression of the Pim1 gene.PMID:21048108
CD27 signals are required for the expansion of interferon-gamma-producing gammadelta27-positive cells.PMID:21037088
LFA-1 signal defect-induced CD8(+) T cell apoptosis is associated with reduced CD27 costimulation and IL-15R survival signal, elucidating the molecular mechanism associated with LFA-1 signaling in effector and memory CD8(+) T cell survivalPMID:20569988
Continuous CD70-CD27 interaction resulted in strongly down-modulated CD27 expression on NK cells and gradually reduced absolute NK cell numbers.PMID:20140903
CD27 signaling directs the IL-2 production that is reportedly essential to sustain survival of virus-specific CTLs in nonlymphoid tissue.PMID:19955658
Data show that the short lifespan of T(H)17 cells was associated with small amounts of the antiapoptotic protein Bcl-2, the IL-15 receptor and the receptor CD27.PMID:19935657
persistent delivery of costimulatory signals via CD27-CD70 interactions, as may occur during chronic active viral infections, can exhaust the T cell pool and is sufficient to induce lethal immunodeficiencyPMID:12469117
Signaling through CD27 during B cell priming inhibits primary antibody responses and induces differentiation into the memory lineage.PMID:14634097
In addition to increasing the frequency of primed antigen-specific T cells, CD27 signaling during the primary response instills a program of differentiation that allows CD8+ T cells to overcome a state of unresponsiveness.PMID:15128787
Stimulation of CD27 on B cells by CD28(+) Th cells accelerates germinal center formation, most likely by promoting centroblast expansion. In addition, CD27 on T cells can partially substitute for CD28 in supporting GC formation.PMID:15187121
The novel costimulatory CD27-CD70 pathway is critical for CD28-independent effector/memory CD8+ alloreactive T cell activation in vivo.PMID:15661893
Hematopoiesis is modulated by immune activation through interactions between CD27 and CD70.PMID:15723067
Triggering of the costimulatory TNF receptor family member CD27 sensitizes T cells for CD95-induced apoptosis.PMID:15879081
During influenza A virus infection, formation of the same CD8+ memory T cell pool as well as its capacity for secondary expansion depend on the complementary contributions of CD27, 4-1BB, and OX40.PMID:16034107
purinergic receptor P2X stimulation by extracellular ATP results in rapid CD27 shedding via protease activationPMID:16207496
Ligation of CD27 on memory cytotoxic T lymphocytes upon secondary antigen encounter increases clonal expansion and improves protection against re-infection with lymphocytic choriomeningitis virus.PMID:16231287
CD27 is a key marker of the natural (NK) cell lineage, dividing the mature Mac-1high NK cell pool into two functionally distinct subsets.PMID:16424180
Data show that during lymphocytic choriomeningitis virus infection, CD27 signaling on CD4+ T cells enhances the secretion of interferon-gamma and tumor necrosis factor-alpha.PMID:16923852
CD27 mediates interleukin-2-independent clonal expansion of the CD8+ T cell without effector differentiation.PMID:17159138
accumulation of mature CD27(low) CD4 T cells in the lungs correlates with the degree of protection against infectionPMID:17202360
Although CD27 is present on influenza virus-specific memory CD8-positive T cells, it is not required for the expansion of properly formed memory cells.PMID:18292513
regulating CD27 expression on memory CTL is a novel mechanism how CD4+ T cells control CTL memoryPMID:18506879
CD27 instills specific functional activities into primed CD4+ T cells; functional impact of CD27 on CD4+ T cells is important for their CD8+ T cell helper activity, to endow memory CD8+ T cells with potential to accumulate after secondary challengePMID:18606659
A 4-stage model of NK-cell maturation CD11b(low)CD27(low) --> CD11b(low)CD27(high) --> CD11b(high)CD27(high) --> CD11b(high)CD27(low).PMID:19234143
CD27 functions as a regulator of the differentiation of gammadelta T cells at least in part by inducing expression of the lymphotoxin-beta receptor and genes associated with trans-conditioning and interferon-gamma production.PMID:19270712
CD27/CD70 interactions at the T-cell/DC interface prime CD8(+) T cells to become tumor-eradicating cytolytic effectors and memory cellsPMID:19279334
The CD27-CD70 costimulatory pathway plays a vital role in sustaining CD4+ T-cell mediated inflammation in colitis; blockade of the pathway leads directly to reduction in T cell numbers, less mucosal inflammation and fewer proinflammatory cytokines.PMID:19525396
the CD70- and CD27-driven costimulatory axis may be involved in shutdown of B cell responses before clearance of AgPMID:19864607
Show
More
Hide
All
Subcellular Location
Membrane; Single-pass type I membrane protein.
Tissue Specificity
In thymus and spleen, but not in non-lymphoid tissues.