MGEFNEKKATCGTVCLKYLLFTYNCCFWLAGLAVMAVGIWTLALKSDYISLLASSTYLAT AYILVVAGVVVMVTGVLGCCATFKERRNLLRLYFILLLIIFLLEIIAGILAYVYYQQLNT ELKENLKDTMVKRYHQSGHEGVSSAVDKLQQEFHCCGSNNSQDWQDSEWIRSGEADSRVV PDSCCKTMVAGCGKRDHASNIYKVEGGCITKLETFIQEHLRVIGAVGIGIACVQVFGMIF TCCLYRSLKLEHY
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Essential for the proper assembly of the glomerular and tubular basement membranes in kidney.
Gene References into Functions
in complex with P2Y12 receptor contributes to thrombus growth and stabilityPMID:26245294
Tetraspanin CD151 Is a Negative Regulator of FcepsilonRI-Mediated Mast Cell ActivationPMID:26136426
Integrin-associated CD151 represses mammary branching morphogenesis by controlling progenitor cell activities, extracellular matrix integrity and transcription program.PMID:25486358
Study provide additional evidence that CD151 acts to enhance tumor formation initiated by a range of oncogenes.PMID:25012362
We identify CD151 as a critical factor in tetradecanoylphorbol acetate-dependent skin carcinogenesis.PMID:23792458
Loss of CD151 is associated with drug sensitivity in skin squamous cell carcinoma.PMID:22824799
study provides strong evidence that CD151 collaborates with LB integrins (particularly alpha6beta4 and ErbB2 (and EGFR) receptors to regulate multiple signaling pathways, thereby driving mammary tumor onset, survival, and metastasisPMID:22952421
establish CD151 as a crucial modifier of integrin-mediated adhesion of podocytes to the GBM and show that blood pressure is an important factor in the initiation and progression of Cd151 knockout-induced nephropathyPMID:22201679
CD151 maintains vascular stability by promoting endothelial cell adhesions, especially cell-cell adhesion, and confining cytoskeletal tension.PMID:21832275
diminished metastasis in CD151-null host animals may be due to impaired tumor-endothelial interactions, with underlying defects in mouse lung endothelial cell extracellular matrix production.PMID:21536858
CD151 controls Met-dependent neoplastic growth by enhancing receptor signaling through beta4 integrin-mediated pathways, independent of cell-substrate adhesionPMID:20937830
CD151 may be involved in the interaction of platelets with the subendothelial matrix at sites of vascular damage [review]PMID:12456024
CD151 plays a key role in selectively strengthening alpha6beta1 integrin-mediated adhesion to laminin-1PMID:12805567
CD151-null mice show phenotypes in several different tissue types: a minor abnormality in hemostasis; keratinocytes migrate poorly in skin explant cultures; T lymphocytes are hyperproliferative in response to in vitro mitogenic stimulation.PMID:15199151
CD151 is essential for normal platelet function and that disruption of CD151 induced a moderate outside-in integrin alpha(IIb)beta(3) signaling defectPMID:15226180
CD151 plays a key role in strengthening alpha3beta1-mediated adhesion in podocytes.PMID:17015618
CD151 modulates molecular organization of laminin-binding integrins, thereby supporting secondary (ie, after cell adhesion) functions of endothelial cells, which are needed for some types of pathologic angiogenesisPMID:17023588
Demonstrate that promoting immobility through a CD151-specific metastasis blocking mAb prevents tumor cell dissemination by inhibiting intravasation without affecting primary tumor growth, tumor cell arrest, extravasation, or growth at the secondary site.PMID:18328426
Data implicate CD151 as a facilitator of laminin-332-mediated keratinocyte functions that impact on the re-epithelialisation process intrinsic to wound healing and further suggest a potential novel role for CD151 in fibroblast migration.PMID:18534576
CD151 is a key regulator of MT1-MMP in endothelial homeostasisPMID:18663148
CD151 appears to be involved in the establishment, maturation, and/or maintenance of the glomerular basement membrane structure in addition to its role in integrin-mediated adhesion strengthening.PMID:18787104
CD37 and CD151 control DC-mediated T-cell activation by two different mechanisms: CD151 regulates co-stimulation whereas CD37 regulates peptide/MHC presentationPMID:19089816