Recombinant Mouse C-X-C chemokine receptor type 2 (Cxcr2)

CSB-CF011673MO
Size:
20ug
20ug100ug
US$1620
Quantity:
Express system: in vitro E.coli expression system
Species: Mus musculus (Mouse)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Orders can only be placed from within the U.S.
Promotion

Product Details

Target Names
Cxcr2
Uniprot NO.
Species
Mus musculus (Mouse)
Source
in vitro E.coli expression system
Expression Region
1-359
Target Protein Sequence
MGEFKVDKFNIEDFFSGDLDIFNYSSGMPSILPDAVPCHSENLEINSYAVVVIYVLVTLL SLVGNSLVMLVILYNRSTCSVTDVYLLNLAIADLFFALTLPVWAASKVNGWTFGSTLCKI FSYVKEVTFYSSVLLLACISMDRYLAIVHATSTLIQKRHLVKFVCIAMWLLSVILALPIL ILRNPVKVNLSTLVCYEDVGNNTSRLRVVLRILPQTFGFLVPLLIMLFCYGFTLRTLFKA HMGQKHRAMRVIFAVVLVFLLCWLPYNLVLFTDTLMRTKLIKETCERRDDIDKALNATEI LGFLHSCLNPIIYAFIGQKFRHGLLKIMATYGLVSKEFLAKEGRPSFVSSSSANTSTTL
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
Buffer
Lyophilized from Tris/PBS-based buffer, 6% Trehalose
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • Recombinant Mouse C-X-C chemokine receptor type 2 (Cxcr2)
Description

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function
Receptor for interleukin-8 which is a powerful neutrophil chemotactic factor. Binding of IL-8 to the receptor causes activation of neutrophils. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system. Binds to IL-8 with high affinity. Also binds with high affinity to CXCL3, GRO/MGSA and NAP-2.
Gene References into Functions
  1. Role of CXCR2 in the control of infection, hypernociception and tissue damage in S. aureus-induced septic arthritis. The kinetics of neutrophil recruitment correlated with the bacterial load recovered from inflamed joints after intra-articular injection of S. aureus. PMID:29168180
  2. Only band III granulocyte myeloid-derived suppressor cells (G-MDSCs) display significant expansion in B16 melanoma, Lewis lung carcinoma, or MC38 colon carcinoma. The expanded G-MDSCs also show increased CXCR2 expression. PMID:29120053
  3. TIARP independently down-regulated CXCL2 and IL-6 production by fibroblast-like synoviocytes, and the expression of chemokine receptors (CXCR1 and CXCR2) in neutrophils, with resultant reduction of neutrophil migration into arthritic joints. PMID:27995997
  4. CXCR2 protein expression was up-regulated in both the epileptic foci of temporal lobe epilepsy patients and in the pilocarpine mouse model. The CXCR2 selective antagonist SB225002, which was i.p. administered during the spontaneous recurrent seizures (SRSs) latency window preceding SRS onset, suppressed SRSs activity during the chronic period of epilepsy. PMID:28705496
  5. inflammation triggered property of Microcystin-LR via IL-8/CXCR2 signaling PMID:29197248
  6. these data provide novel insight into a dynamic IL-17A-CXCR2-neutrophil axis during acute segmented filamentous bacteria colonization and demonstrate a central role for neutrophils in limiting segmented filamentous bacteria expansion PMID:27624780
  7. Combining CSF1R inhibitor with a CXCR2 antagonist blocked granulocyte infiltration of tumors and showed strong anti-tumor effects. PMID:29136508
  8. we conclude that CXCR2 is required for the recruitment of TANs, which in turn can suppress antitumor T-cell responses. We showed that CXCR2 ligands, particularly CXCL5, are elevated in both human and mouse PDA. PMID:27737879
  9. Results demonstrated that complete Freund's adjuvant increased CXCL1 and CXCR2 expression in the dorsal root ganglion, with the cellular distribution in all sizes neurons. In addition, specific inhibition of CXCR2 in the dorsal root ganglion attenuated established inflammatory pain. PMID:27697507
  10. postnatal development of the intestinal microbiota is an important susceptibility factor for experimental biliary atresia, which involves Cxcr2 signaling PMID:28763485
  11. this study demonstrates CXCR2-driven activation of NLRP3 inflammasome in macrophages, and indicates a potential host-directed therapeutic target to limit the damaging inflammation associated with overt production of proinflammatory IL-1beta PMID:28739876
  12. upregulation of CCRL2 observed under inflammatory conditions is functional to finely tune CXCR2-mediated neutrophil recruitment at sites of inflammation. PMID:28743719
  13. RelA has a role in regulating OIS in preneoplastic lesions; the RelA/CXCL1/CXCR2 axis is an essential mechanism of tumor surveillance in pancreatic ductal adenocarcinoma PMID:27454298
  14. TNFalpha-activated mesenchymal stromal cells promote breast cancer metastasis by recruiting PMID:27375023
  15. These data demonstrate that the CXCR2 network and CXCL4 play a role in the maintenance of normal HSC/HPC cell fates, including survival and self-renewal. PMID:27222476
  16. the results of this study indicate a new potential use for gastrin-releasing peptide receptor antagonist for treatment of drug-induced liver injury through a mechanism involving adhesion molecule modulation and possible direct binding to CXCR2 PMID:28294319
  17. this study shows that astragaloside IV alleviates E. coli-caused peritonitis through modulating GRK2-CXCR2 signal in neutrophils PMID:27543854
  18. Study shows that CXCR2 signaling in the myeloid compartment is tumor promoting and required for pancreatic cancer metastasis. PMID:27265504
  19. CXCR2/CXCL1 axis promotes granulocytic myeloid-derived suppressor cells recruitment and facilitates arginase I expression and activity of these cells at maternal-fetal interface PMID:27027573
  20. CXCR2 plays a critical role in particle-induced osteolysis. PMID:26939934
  21. This study demonstated that endothelial CXCR2 play essential roles in cerebral endothelial activation and subsequent leukocyte recruitment during neuroinflammation. PMID:25990934
  22. Studied DC-specific TLR4 signaling on host defense against intra-abdominal polymicrobial sepsis; found TLR4 deletion on DCs was associated with lower levels of IL-10, higher PMN accumulation in the peritoneal cavity, and higher expression of CXCR2. PMID:26603204
  23. CXCL1 monomer-dimer distribution and receptor interactions are highly coupled and regulate neutrophil trafficking and that injury in the context of disease is a consequence of inappropriate CXCR2 activation PMID:26138727
  24. p53-mediated induction of PAI-1 expression due to chronic CS exposure exacerbates lung inflammation through elaboration of CXCL1, CXCL2, and CXCR2. PMID:26747783
  25. Suggest chemotherapy-specific differential regulation of CXCR2 ligands, stem cell-like and mesenchymal phenotypes, and enhanced metastasis in drug-resistant cells and targeting CXCR2 signaling, may help circumvent therapy resistance in breast cancer. PMID:26797460
  26. Serum amyloid A1alpha induces paracrine IL-8/CXCL8 via TLR2 and directly synergizes with this chemokine via CXCR2 and formyl peptide receptor 2 to recruit neutrophils. PMID:26297794
  27. Blockade of CXCR2 during Hpb challenge infection reproduced the delayed wound repair observed in helminth infected Aid-/- and Fcrg-/- mice. PMID:25806513
  28. CXCR2 and CX3CR1 differentially regulate EPC functional responses during atheroregression PMID:25765938
  29. CXCr2 regulates the hepatic proliferative response and subsequent liver regeneration. PMID:25756662
  30. Data revealed a critical role of a PDZ-based CXCR2 macromolecular complex in EPC homing and angiogenesis. PMID:25622052
  31. CXCR2 antagonization reduced neurological deficits and infarct volumes that were exacerbated in hyperlipidemic ApoE-/- mice. PMID:26337969
  32. LPS-induced induction of G protein-coupled receptor kinase 2 (GRK2) and down-regulation of CXCR2 are markedly attenuated in PLD2(-/-) mice. PMID:26282875
  33. CXCR2 is critically involved in the development of acute and chronic pancreatitis in mice, and its inhibition or loss protects against pancreatic damage. PMID:25950520
  34. data demonstrate that CXCR2 regulates bone marrow blood vessel repair/regeneration and haematopoietic recovery, and clinically may be a therapeutic target for improving bone marrow transplantation. PMID:25757087
  35. ADAM17 induction down-regulates the receptor in an irreversible manner and may serve as a master switch in controlling CXCR2 function. PMID:25412626
  36. these results demonstrate that host Cxcr2-dependent signaling regulates mammary tumor growth and metastasis by promoting angiogenesis and pro-inflammatory responses. PMID:25511644
  37. Studied the expression and function of chemokine receptor CXCR2 and CXCR7 in the rat with acute leukemia. PMID:25063073
  38. Macrophages and beta-cells produce the chemokines CXCL1 and CXCL2, recruiting CXCR2-expressing neutrophils from the blood to the pancreatic islets. PMID:24968718
  39. KC and/or CXCR2 contribute to the pathogenesis of globoid-cell Leukodystrophy. PMID:23755134
  40. shRNA-induced HIF-1alpha and IL-8 knockdown inhibit angiogenesis and tumour growth in hepatocellular carcinoma. PMID:24321089
  41. In TPA-induced skin inflammation, MIF is released from damaged keratinocytes and then triggers the chemotaxis of CD74(+)CXCR2(+) NKT cells for IFN-gamma production. PMID:25172501
  42. Disruption of CXCR2-mediated myeloid derived suppressor cell tumor trafficking enhances anti-PD1 efficacy in rhabdomyosarcomas. PMID:24848257
  43. demonstrate that IBE-elicited signals increase SDF-1 expression through the CXCR2/miR-223/miR-27b pathway in C6 astrocytoma cells and primary astrocytes PMID:24999035
  44. Lung cancer promotion by inflammation is partly mediated by activation of the IL-8/CXCR2 pathway and subsequent recruitment of neutrophils and release of neutrophil elastase. PMID:24321240
  45. we show that orchestrated action of CXCR2 and leukotriene B4 receptor BLT1 plays a key role in neutrophil recruitment during the development of imiquimod (IMQ)-induced psoriatic skin lesions in mice PMID:24663678
  46. our study provides a therapeutic justification of combined inhibition of CXCR2 and sulindac treatment in colon cancer prevention. PMID:24338666
  47. CXCR2, the primary receptor of CXCL1, is upregulated in dorsal horn neurons in neuropathic pain. PMID:23831863
  48. these results indicate that GRK6 complexes with AGS3-Galphai2 to regulate CXCR2-mediated leukocyte functions at different levels, including downstream effector activation, receptor trafficking, and expression at the cell membrane. PMID:24510965
  49. IL-33 cooperated with IL-17A to exacerbate airway hyperresponsiveness by enhancing neutrophilic inflammation via CXCR2 signaling; furthermore, CXCR2 signaling derived Th2 responses. PMID:24446518
  50. Suggest that KC/IL-8 and its receptor CXCR2 are critical and major mediators of organ cross talk in DSS colitis and neutralization of CXCR2 will help to reduce the incidence of acute kidney injury due to ulcerative colitis and Crohn's disease in humans. PMID:23986515

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products