Recombinant Mouse C-X-C chemokine receptor type 1 (Cxcr1)

Code: CSB-CF800386MO
Size:
20μg
20μg100μg
US$5121
Quantity:
Express system: in vitro E.coli expression system
Species: Mus musculus (Mouse)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
Cxcr1
Uniprot NO.
Species
Mus musculus (Mouse)
Source
in vitro E.coli expression system
Expression Region
1-351
Target Protein Sequence
MAEAEYFIWTNPEGDFEKEFGNITGMLPTGDYFIPCKRVPITNRQALVVFYALVSLLSLL GNSLVMLVILYRRRTRSVMDVYVLNLAIADLLFSLTLPFLAVSKLKGWIFGTPLCKMVSL LKEFNFFSGILLLACISVDRYLAIVHATRTLARKRYLVKFVCVGIWGLSLILSLPFAIFR QAYKPFRSGTVCYEVLGEATTDFRMTLRGLSHIFGFLLPLLTMLVCYGLTLRMLFKTHMR QKHRAMGVIFAVVLVFLLCCLPYNLVLLSDTLLGAHLIEDTCERRNDIDQALYITEILGF SHSCLNPIIYAFVGQNFRHEFLKILANHGLVRKEVLTHRRVAFHTSLTAIY
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Receptor to interleukin-8, which is a powerful neutrophils chemotactic factor. Binding of IL-8 to the receptor causes activation of neutrophils. This response is mediated via a G-protein that activate a phosphatidylinositol-calcium second messenger system.
Gene References into Functions
  1. these studies define CXCR1 as a novel, noncanonical chemokine receptor that regulates pulmonary anti-Pseudomonas host defense with broad implications for cystic fibrosis, chronic obstructive pulmonary disease and other infectious lung diseases PMID:26950764
  2. CXCR1 and CXCR2 regulate hepatocyte exosome release. The mechanism utilized by CXCR1 remains elusive, but CXCR2 appears to modulate Nsm activity and resultant production of ceramide to control exosome release. CXCR1 is required for packaging of enzymes into exosomes that mediate their hepatocyte proliferative effect. PMID:27551720
  3. These data demonstrate a biological function for mouse Cxcr1 in vivo and indicate that CXCR1-dependent neutrophil effector function is a critical innate protective mechanism of fungal clearance and host survival in systemic candidiasis. PMID:26791948
  4. in view of recently-published experimental data obtained in NOD mice, we argue for possible Cxcr1 involvement in type 1 diabetes pathogenesi PMID:26230114
  5. expressed 33-110-fold higher in hepatocellular carcinoma polymorphonuclear myeloid-derived suppressor cells PMID:25891236
  6. CXCR1 expression is induced in staphylococcus aureus-infected macrophages but not in control macrophages. PMID:25129059
  7. Pharmacologic blockade of CXCR1/2 as well as genetic deletion of NAP-2 markedly reduced leukocyte shape change and intrathrombus migration. PMID:23550035
  8. Blockade of the CXCL1-CXCR1/2 axis in mice improved intrahepatic islet engraftment. The CXCR1/2-mediated pathway is a regulator of islet damage. PMID:22996693
  9. Upon activation by CXCL8, CXCR1 predominantly couples to G protein-coupled receptor kinase (GRK)2 to modulate leukocyte functions. PMID:22869904
  10. Xiaotan Sanjie Decoction XTSJD can decrease the protein expressions of IL-8 and its receptors CXCR1/CXCR2 in tumor xenografts and gastric tissue adjacent to the tumor. PMID:20082763
  11. data suggest that CXCR1 does not mediate the proliferative effects of ELR+ CXC chemokines during liver regeneration after partial hepatectomy PMID:21693308
  12. CXCR1 expression is induced in hepatocytes after injury. Furthermore, the data suggest that CXCR1 has divergent effects from CXCR2 and appears to facilitate repair and regenerative responses after I/R injury. PMID:21254176
  13. CX3CL1-CX3CR1 axis can regulate the expression of iNOS, a crucial mediator of DSS-induced colitis. PMID:20335311
  14. mCXCR1 may mediate the recruitment of neutrophils to the inflammation site under certain infections PMID:15967374
  15. The gene encoding mCXCR1-like was mapped to mouse chromosome 1 and its genomic organization was determined to be very similar to the organization of the gene encoding hCXCR1. PMID:16084593
  16. CXCR1 is a functional receptor for GCP-2/CXCL6 and interleukin-8/CXCL8 in mouse PMID:17197447
  17. CXCR1 cleavage on neutrophils disables bacterial killing in cystic fibrosis lung disease PMID:18059279
  18. Blockade of CXCR1/CXCR2 receptors inhibits neutrophil recruitment by inhibiting the adhesion of neutrophils to synovial microvessels. As a consequence, there is decreased local cytokine production and ameloriation of arthritis in the tissue. PMID:18668539

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products