Ccr9; Cmkbr10; C-C chemokine receptor type 9; C-C CKR-9; CC-CKR-9; CCR-9; Chemokine C-C receptor 10; CD antigen CDw199
Species
Mus musculus (Mouse)
Source
in vitro E.coli expression system
Expression Region
1-369
Target Protein Sequence
MMPTELTSLIPGMFDDFSYDSTASTDDYMNLNFSSFFCKKNNVRQFASHFLPPLYWLVFI VGTLGNSLVILVYWYCTRVKTMTDMFLLNLAIADLLFLATLPFWAIAAAGQWMFQTFMCK VVNSMYKMNFYSCVLLIMCISVDRYIAIVQAMKAQVWRQKRLLYSKMVCITIWVMAAVLC TPEILYSQVSGESGIATCTMVYPKDKNAKLKSAVLILKVTLGFFLPFMVMAFCYTIIIHT LVQAKKSSKHKALKVTITVLTVFIMSQFPYNSILVVQAVDAYAMFISNCTISTNIDICFQ VTQTIAFFHSCLNPVLYVFVGERFRRDLVKTLKNLGCISQAQWVSFTRREGSLKLSSMLL ETTSGALSL
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Receptor for chemokine SCYA25/TECK. Subsequently transduces a signal by increasing the intracellular calcium ions level.
Gene References into Functions
these results showed a site- and cell-specific expressions of Ccl25 and its receptor Ccr9 within both maternal and embryonic compartments of implantation sites and suggested a role in inducing specific Ccr9+ leukocytes at the maternal-fetal interface during the initial steps of embryo implantation in the mouse modelPMID:29154408
Abrogation of CCR9 improved the post-myocardial infarction survival rate and left ventricular (LV) dysfunction and decreased the infarct size. The data reveal that CCR9 serves as a novel modulator of pathological progression following myocardial infarction through NF-kappaB and MAPK signaling.PMID:27585634
Pressure overload-induced hypertrophy was greatly attenuated by CCR9 deficiency in cardiac-specific CCR9 knockout mice, whereas CCR9 overexpression in cardiac-specific transgenic mice strikingly enhanced cardiac hypertrophy.PMID:27146447
CCR9 and CCL25 expressions are induced in the early stages of airway inflammation and they have an important role modulating eosinophils and lymphocytes recruitment at the first stages of inflammatory processPMID:27795621
CCR9 and Integrin-beta7 expression has a differential effect on graft fate during acute graft-versus-host disease (GVHD) of the liver depending on the GVHD target tissue.PMID:26348893
data indicate that in addition to acting as a gut-homing molecule, CCR9 signaling shapes immune responses by inhibiting Treg cell developmentPMID:26230654
Data suggest that blocking CC chemokine receptor 9 (CCR9) may represent a novel safe therapy for rheumatoid arthritis (RA).PMID:25248373
activation of Notch1 has a dominant-negative effect on Ccr9 transcription and that Notch1 and E proteins control the dynamic expression of Ccr9 during T cell development.PMID:25710912
CCR9/CCL25 is involved in acute skin transplantation rejection and anti-CCL25 strategies might be useful in preventing acute rejection.PMID:23456208
Accumulated CD11b(+) macrophages are critical for activating hepatic stellate cells through the CCR9/CCL25 axis and therefore promote liver fibrosis.PMID:23460364
CCR9-expressed plasmacytoid dendritic cells are possibly small intestine regulatory, antigen-presenting cells that suppress intestinal inflammation.PMID:22626536
CCR9 is required for recruitment of peritoneal macrophages in the steady state to control systemic sepsis during early phases of peritoneal infection.PMID:22771342
Data show that chemokine receptor CCR9(-/-) knockout mice developed a chronic inflammatory response with over-expression of the cytokines and chemokines.PMID:22633147
characterization of expression and thymus-expressed chemokine responsiveness of the murine thymus, spleen and mesenteric lymph nodePMID:22196895
CCR9(+) macrophages contribute to the induction of acute liver inflammation in mouse models of hepatitis.PMID:22079594
CCL25/CCR9 interactions regulate inflammatory immune responses in the large intestinal mucosa by balancing different subsets of dendritic cells.PMID:21283540
Signaling of the chemokine CCL25 through its receptor CCR9 induces Tregs to migrate to the intestine.PMID:21300065
CCR9+ Th cells are a subset of IL-21-producing T helper cells that influence regional specification of autoimmune diseases that affect accessory organs of the digestive systemPMID:21511186
Critical role of chemokine receptor signaling in thymic settling.PMID:19965655
A previously unrecognized role of CCR7 in progenitor seeding of the adult thymus, which is largely masked by compensatory effects of CCR9 signals.PMID:20040757
Characterization of CCR9 expression during T cell developmentPMID:11751956
CCR9 plays an important, although not indispensable, role in regulating the development and/or migration of both alphabeta negative and gammadelta negative T lymphocytes.PMID:11884450
in vivo neutralization of the CCR9 ligand, CCL25, reduced the ability of activated CCR9(+) CD8alphabeta(+) lymphocytes cells to populate the small-intestinal epitheliumPMID:12393847
mice doubly deficient for chemokine receptors CCR7 and CCR9 were defective specifically in fetal thymus colonization before, but not after, thymus vascularizationPMID:16809609
fms-like tyrosine kinase receptor-3 signaling is required for the generation of T lineage-competent progenitors, which selectively express molecules, including CCR9PMID:17277104
CCR9 is a homing receptor for plasmacytoid dendritic cells to the small intestine.PMID:17404233
Demonstrate development of intestinal inflammation in Tnf(DeltaARE) mice is critically dependent on beta7 integrin-mediated T-lymphocyte recruitment. the function of the CCL25/CCR9 axis appears dispensable in this model.PMID:18439426
CCR9 is expressed on gut-homing T cells after stimulation by dendritic cells from Peyer's patches, but not DC of other tissue origins, thereby imprinting gut homing specificity onto memory T cells specific for gut-antigens.PMID:12840763
This gene is a mouse CCR9. See also GenBank files AJ132336 and AJ131357.PMID:10229797
Show
More
Hide
All
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Highly expressed in the thymus and low in lymph nodes and spleen.