Recombinant Mouse C-C chemokine receptor type 9 (Ccr9)

Code: CSB-CF894369MO
Size:
20μg
20μg100μg
US$5256
Quantity:
Express system: in vitro E.coli expression system
Species: Mus musculus (Mouse)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
Ccr9
Uniprot NO.
Species
Mus musculus (Mouse)
Source
in vitro E.coli expression system
Expression Region
1-369
Target Protein Sequence
MMPTELTSLIPGMFDDFSYDSTASTDDYMNLNFSSFFCKKNNVRQFASHFLPPLYWLVFI VGTLGNSLVILVYWYCTRVKTMTDMFLLNLAIADLLFLATLPFWAIAAAGQWMFQTFMCK VVNSMYKMNFYSCVLLIMCISVDRYIAIVQAMKAQVWRQKRLLYSKMVCITIWVMAAVLC TPEILYSQVSGESGIATCTMVYPKDKNAKLKSAVLILKVTLGFFLPFMVMAFCYTIIIHT LVQAKKSSKHKALKVTITVLTVFIMSQFPYNSILVVQAVDAYAMFISNCTISTNIDICFQ VTQTIAFFHSCLNPVLYVFVGERFRRDLVKTLKNLGCISQAQWVSFTRREGSLKLSSMLL ETTSGALSL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Receptor for chemokine SCYA25/TECK. Subsequently transduces a signal by increasing the intracellular calcium ions level.
Gene References into Functions
  1. these results showed a site- and cell-specific expressions of Ccl25 and its receptor Ccr9 within both maternal and embryonic compartments of implantation sites and suggested a role in inducing specific Ccr9+ leukocytes at the maternal-fetal interface during the initial steps of embryo implantation in the mouse model PMID:29154408
  2. Abrogation of CCR9 improved the post-myocardial infarction survival rate and left ventricular (LV) dysfunction and decreased the infarct size. The data reveal that CCR9 serves as a novel modulator of pathological progression following myocardial infarction through NF-kappaB and MAPK signaling. PMID:27585634
  3. Pressure overload-induced hypertrophy was greatly attenuated by CCR9 deficiency in cardiac-specific CCR9 knockout mice, whereas CCR9 overexpression in cardiac-specific transgenic mice strikingly enhanced cardiac hypertrophy. PMID:27146447
  4. CCR9 and CCL25 expressions are induced in the early stages of airway inflammation and they have an important role modulating eosinophils and lymphocytes recruitment at the first stages of inflammatory process PMID:27795621
  5. CCR9 and Integrin-beta7 expression has a differential effect on graft fate during acute graft-versus-host disease (GVHD) of the liver depending on the GVHD target tissue. PMID:26348893
  6. data indicate that in addition to acting as a gut-homing molecule, CCR9 signaling shapes immune responses by inhibiting Treg cell development PMID:26230654
  7. Data suggest that blocking CC chemokine receptor 9 (CCR9) may represent a novel safe therapy for rheumatoid arthritis (RA). PMID:25248373
  8. activation of Notch1 has a dominant-negative effect on Ccr9 transcription and that Notch1 and E proteins control the dynamic expression of Ccr9 during T cell development. PMID:25710912
  9. CCR9/CCL25 is involved in acute skin transplantation rejection and anti-CCL25 strategies might be useful in preventing acute rejection. PMID:23456208
  10. Accumulated CD11b(+) macrophages are critical for activating hepatic stellate cells through the CCR9/CCL25 axis and therefore promote liver fibrosis. PMID:23460364
  11. CCR9-expressed plasmacytoid dendritic cells are possibly small intestine regulatory, antigen-presenting cells that suppress intestinal inflammation. PMID:22626536
  12. CCR9 is required for recruitment of peritoneal macrophages in the steady state to control systemic sepsis during early phases of peritoneal infection. PMID:22771342
  13. Data show that chemokine receptor CCR9(-/-) knockout mice developed a chronic inflammatory response with over-expression of the cytokines and chemokines. PMID:22633147
  14. characterization of expression and thymus-expressed chemokine responsiveness of the murine thymus, spleen and mesenteric lymph node PMID:22196895
  15. CCR9(+) macrophages contribute to the induction of acute liver inflammation in mouse models of hepatitis. PMID:22079594
  16. CCL25/CCR9 interactions regulate inflammatory immune responses in the large intestinal mucosa by balancing different subsets of dendritic cells. PMID:21283540
  17. Signaling of the chemokine CCL25 through its receptor CCR9 induces Tregs to migrate to the intestine. PMID:21300065
  18. CCR9+ Th cells are a subset of IL-21-producing T helper cells that influence regional specification of autoimmune diseases that affect accessory organs of the digestive system PMID:21511186
  19. Critical role of chemokine receptor signaling in thymic settling. PMID:19965655
  20. A previously unrecognized role of CCR7 in progenitor seeding of the adult thymus, which is largely masked by compensatory effects of CCR9 signals. PMID:20040757
  21. Characterization of CCR9 expression during T cell development PMID:11751956
  22. CCR9 plays an important, although not indispensable, role in regulating the development and/or migration of both alphabeta negative and gammadelta negative T lymphocytes. PMID:11884450
  23. in vivo neutralization of the CCR9 ligand, CCL25, reduced the ability of activated CCR9(+) CD8alphabeta(+) lymphocytes cells to populate the small-intestinal epithelium PMID:12393847
  24. mice doubly deficient for chemokine receptors CCR7 and CCR9 were defective specifically in fetal thymus colonization before, but not after, thymus vascularization PMID:16809609
  25. fms-like tyrosine kinase receptor-3 signaling is required for the generation of T lineage-competent progenitors, which selectively express molecules, including CCR9 PMID:17277104
  26. CCR9 is a homing receptor for plasmacytoid dendritic cells to the small intestine. PMID:17404233
  27. Demonstrate development of intestinal inflammation in Tnf(DeltaARE) mice is critically dependent on beta7 integrin-mediated T-lymphocyte recruitment. the function of the CCL25/CCR9 axis appears dispensable in this model. PMID:18439426
  28. CCR9 is expressed on gut-homing T cells after stimulation by dendritic cells from Peyer's patches, but not DC of other tissue origins, thereby imprinting gut homing specificity onto memory T cells specific for gut-antigens. PMID:12840763
  29. This gene is a mouse CCR9. See also GenBank files AJ132336 and AJ131357. PMID:10229797

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Highly expressed in the thymus and low in lymph nodes and spleen.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products