QDEVTDDYIGENTTVDYTLYESVCFKKDVRNFKAWFLPLMYSVICFVGLLGNGLVILTYI YFKRLKTMTDTYLLNLAVADILFLLILPFWAYSEAKSWIFGVYLCKGIFGIYKLSFFSGM LLLLCISIDRYVAIVQAVSAHRHRARVLLISKLSCVGIWMLALFLSIPELLYSGLQKNSG EDTLRCSLVSAQVEALITIQVAQMVFGFLVPMLAMSFCYLIIIRTLLQARNFERNKAIKV IIAVVVVFIVFQLPYNGVVLAQTVANFNITNSSCETSKQLNIAYDVTYSLASVRCCVNPF LYAFIGVKFRSDLFKLFKDLGCLSQERLRHWSSCRHVRNASVSMEAETTTTFSP
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Data report that CCR7 mediates CD11c+ cell migration from the CNS parenchyma to the meningeal lymphoid vessels and eventually to the deep cervical lymph nodes during neuroinflammation. In the absence of CCR7, dendritic cells are retained in the CNS and exacerbate neuroinflammation.PMID:28216674
Conditions for optimal dendritic cells guidance are perfectly provided by the CCL21 gradients measured in vivo. Furthermore, CCR7 signal termination by the G-protein-coupled receptor kinase 6 (GRK6) is crucial for haptotactic but dispensable for chemotactic CCL21 gradient sensing in vitro and confirm those observations in vivo.PMID:28457871
CCR7 deficiency results in apoptosis of Sirpa- dendritic cells, which is counterbalanced by expansion of immature Sirpa+ dendritic cells that efficiently induce Treg generation.PMID:28978470
These data show that CCR7-CCL19/CCL21 axis facilitates retention CD4(+) T lymphocytes at the site of collateral artery remodeling, which is essential for effective arteriogenesis.PMID:28275068
Results demonstrated that the deletion of CCR7 significantly decreases levels of activated Notch1, and provide evidence that crosstalk between CCR7 and Notch1 promotes stemness in mammary cancer cells ultimately potentiating mammary tumor progression.PMID:28137279
CCR7 deficiency lead to accumulation of CD8+ adipose tissue leukocytes, which was further exacerbated by HFD feeding.PMID:27655794
in the current study, we used interval mapping to validate a locus on Chr 15, named Ity8, linked to Salmonella resistance in AcB60 mice. Global gene expression analysis during infection identified AcB60-specific expression of genes involved in Ccr7 signaling, including downstream effector Mapk11 (mitogen-activated protein kinase 11), located within the Ity8 interval, and representing a potential positional candidate genePMID:27913859
Taken together, these data suggest that CCR7 biases memory CD8 T cells toward IL-7-dependent niches over IL-15-dependent niches, which provides insight into the homeostatic regulation of different memory T-cell subsets.PMID:27385825
Prominent mucosal immune responses in CCR7-deficient mice increased the efficiency of bacteria clearance from the FRT(female reproductive tract) while reducing tissue-associated inflammation and pathology; increased numbers of lymphocytes within the FRT result in pathogen clearance with reduced immune-mediated pathologyPMID:28801359
CCR7 is required to mount a robust immune response against enteropathogenic Y. pseudotuberculosis by promoting Th17-like responses in mesenteric lymph nodes.PMID:28329174
CCR7 overexpression and RelB knockdown (KD) in imDCs improve skin-graft survival in a murine skin-transplantation model. Transfection with Ad-CCR7 and RelB KD in imDCs may be an effective approach inducing immune tolerance, thus being potentially valuable for inhibiting allograft rejection.PMID:28578354
data point to Ccr7 as a critical host defense restriction factor limiting neuroinflammation during acute West Nile virus infectionPMID:28356527
The results suggest that CCR7 plays a causal role in maintaining innate and adaptive immunity in obesity.PMID:27207557
these data indicate that CCR7 and BTLA cooverexpression imparts an intermediate immune phenotype in mmature dendritic cells when compared to that in CCR7- or BTLA-expressing counterparts that show a more immunocompetent or immunotolerant phenotypePMID:28393074
Results suggest that baicalin exerts an inhibitory effect on airway inflammation, and this effect may be associated with the inhibition of CCR7 and its ligands, CCL19 and CCL21, as well as on the nuclear factor-Kappa B (NF-kappaB) pathway in a mouse model of asthma.PMID:27666000
This study reveals a role for CCR7 in limiting Treg recirculation back to the thymus and enables separation of the mechanisms controlling Treg production and thymic recirculation.PMID:26832402
expression on antiviral T cells is mandatory to prevent lethal neuroinflammatory diseasePMID:26921107
data reveal that CCR7 plays multifaceted roles in regulating collecting vessel permeability and fibrosis, with one of the key players being IRF4-dependent DCs.PMID:26999610
the graft site microenvironment plays a critical role in alloimmunity by determining DC trafficking through the CCR7-CCL19/21 axis.PMID:27031839
reduced expression in mononuclear inflammatory cells isolated from the brain during active stage of experimental autoimmune encephalomyelitisPMID:25957582
The results highlight a novel role of CCR7 in regulating effector CD8 T cell migration in the spleen and demonstrate differential requirement of CCR7 for primary and secondary CD8 T cell responses to infection.PMID:26500349
mucosal draining lymph nodes express CCR7, which has a role in trafficking of RORgamma innate lymphoid cellsPMID:25575242
results demonstrate a contribution of CCR7 to STAP-2-dependent enhancement of BCR-ABL-mediated cell growth in Ba/F3 cellsPMID:26102025
CCR7 increases the secretion of nitric oxide and modulates the T cell immune response.PMID:25549354
Results suggest that Mfn2 and OPA1 are upregulated during bone marrow progenitor differentiation and promote the migration of immature dendritic cells by regulating the expression of CCR7.PMID:25387754
CCR7 regulates the intestinal TH1/TH17/Treg balance during Crohn's-like murine ileitis.PMID:25637591
Rescue with both CCR7 and ICAM-1 reverses impaired DC homing to lymph nodes in vivo when FOXO1 is deleted.PMID:25786691
Ccr7 is gradually silenced during the differentiation of monocytes to monocyte-derived dendritic cells.PMID:25297875
CCR7 is required for a protective immune response to intracellular L. major infection.PMID:24205367
CCR7 guides migration of mesenchymal stromal cells to secondary lymphoid organs and thus highly intensify their in vivo immunomodulatory effects.PMID:24496849
The involvement of DCs and their expression of CCR7 in corneal and ocular surface diseases such as in ocular allergy, dry eye disease, immune rejection and more, are also reviewed here.PMID:24725321
CCR7 directs the recruitment of T cells into inflamed pancreatic islets of nonobese diabetic (NOD) micePMID:24687731
Results suggest reduced interest in social novelty in response to maternal separation in CCR7-/-, but not wild-type micePMID:24503116
The results of this study suggest that ccr7 may play a role in cognition and learning behaviour, as well as anxiety and other behaviours.PMID:24333375
Novel roles for CCR7 are identified during intrathymic T cell development, highlighting its importance in enabling multiple alphabetaT cell lineages to access the adult thymic medulla.PMID:24990081
Immunohistology revealed that CCR7 and CCR9 expression was important for gammadelta T-cell localization within thymic medulla or cortex, respectivelyPMID:24500801
results indicate that CCR7 must be expressed on dendritic cells, as well as peripheral cells, to allow an efficient immune response to Leishmania majorPMID:24410820
Post-thrombotic vein wall remodeling is impaired in CCR7(-/-) mice, with a profibrotic phenotype, is dependent on the thrombotic mechanism, and is mediated by circulating CCR7(+) cells.PMID:24311382
CCR7 provides localized access to IL-2 and defines homeostatically distinct regulatory T cell subsets.PMID:24378538
TSLP activated a subset of CD11b(+) DCs in the skin to produce CCL17, upregulate CCR7, and migrate to the draining lymph node to initiate Th2 differentiation.PMID:24123684
Chromatin immunoprecipitation sequencing revealed the transcription factor Tcf7 and the chemokine receptor Ccr7 as Foxo1-bound target genes, which have critical functions in central-memory T cell differentiation and trafficking.PMID:23932570
our findings do not support the notion that CCR7 plays a discernable role in the trafficking of Ag-experienced CD4 T cells to the lymph nodesPMID:23935190
Genetic deletion of Ccr7 exacerbates atherosclerosis by increasing T cell accumulation in atherosclerotic lesions.PMID:23180724
Data indicate that naive lung CD4 cells supply the draining lymph nodes through a CD62L-independent, CCR7-dependent pathway.PMID:23319636
Exposure to CCR7 in a model of contact hypersensitivity following sublethal total body irradiation results in diminished immunosurveillance in the skin, a mechanism which could render the host more susceptible to pathogens.PMID:23002435
these data imply a causal link between CCR7 expression, IL-1beta level, and Na malabsorption owing to altered ENaC expression and diarrhea.PMID:22395421
Phosphatidylinositol 3-kinase and NF-kappa B signaling pathways play a critical role in CCR7-mediated IL-23 production by murine dendritic cells.PMID:22591694
Plasmacytoid dendritic cells (pDCs) trafficking to the splenic white pulp require CCR7 signaling.PMID:22634622
CCR7 expression contributes to the immunopathogenesis of allergic conjuctivitis, thereby allowing significant inhibition of this experimental condition via topical CCR7 antibody blockade.PMID:22507838
Cell sorting highlighted the involvement of CD11c(+) cells in the CCR7-independent transport.PMID:22622847