Home
Product
Protein
Transmembrane Proteins
Recombinant Mouse C-C chemokine receptor type 11 (Ccrl1)

Recombinant Mouse C-C chemokine receptor type 11 (Ccrl1)

Code: CSB-CF835667MO

Rate （N/A）
Review （0）

Size:

20μg100μg

US$5113

Quantity:

Express system: in vitro E.coli expression system

Species: Mus musculus (Mouse)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

Ackr4

Uniprot NO.

Q924I3

Alternative Names

Ackr4; Ccr11; Ccrl1; Atypical chemokine receptor 4; C-C chemokine receptor type 11; C-C CKR-11; CC-CKR-11; CCR-11; CC chemokine receptor-like 1; CCRL1; CCX CKR

Species

Mus musculus (Mouse)

Source

in vitro E.coli expression system

Expression Region

1-350

Target Protein Sequence

MALELNQSAEYYYEENEMNYTHDYSQYEVICIKEEVRQFAKVFLPAFFTVAFVTGLAGNS VVVAIYAYYKKQRTKTDVYILNLAVADLLLLITLPFWAVNAVHGWILGKMMCKVTSALYT VNFVSGMQFLACISIDRYWAITKAPSQSGAGRPCWIICCCVWMAAILLSIPQLVFYTVNQ NARCTPIFPHHLGTSLKASIQMLEIGIGFVVPFLIMGVCYASTARALIKMPNIKKSRPLR VLLAVVVVFIVTQLPYNVVKFCQAIDAIYLLITSCDMSKRMDVAIQVTESIALFHSCLNP ILYVFMGASFKNYIMKVAKKYGSWRRQRQNVEEIPFDSEGPTEPTSSFTI
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Atypical chemokine receptor that controls chemokine levels and localization via high-affinity chemokine binding that is uncoupled from classic ligand-driven signal transduction cascades, resulting instead in chemokine sequestration, degradation, or transcytosis. Also known as interceptor (internalizing receptor) or chemokine-scavenging receptor or chemokine decoy receptor. Acts as a receptor for chemokines CCL2, CCL8, CCL13, CCL19, CCL21 and CCL25. Chemokine-binding does not activate G-protein-mediated signal transduction but instead induces beta-arrestin recruitment, leading to ligand internalization. Plays an important role in controlling the migration of immune and cancer cells that express chemokine receptors CCR7 and CCR9, by reducing the availability of CCL19, CCL21, and CCL25 through internalization. Negatively regulates CXCR3-induced chemotaxis. Regulates T-cell development in the thymus and inhibits spontaneous autoimmunity.

Gene References into Functions

a comprehensive model of CCL19 and CCL21 transport and gradient formation in the lymph nodes (LNs) was built; predicts that ACKR4 in LNs prevents CCL19/CCL21 accumulation in efferent lymph, but does not control intranodal gradients; instead, it attributes the disrupted interfollicular CCL21 gradients observed in Ackr4-deficient LNs to ACKR4 loss upstream PMID:28807994
ACKR4 on stromal cells aids the egress of antigen presenting cells from mouse skin, and, during inflammation, facilitates CCR7-dependent cell trafficking by scavenging CCL19. PMID:26976955
The data shows a novel function for the chemokine receptor CCX-CKR as a regulator of TGF-beta1 expression and epithelial-mesenchymal transition in breast cancer cells. PMID:25027038
CCRL1 is expressed in key thymic microenvironments but is dispensable for T lymphopoiesis at steady state in adult mice. PMID:25521433
stepwise acquisition of chemokine (C-C motif) receptor-like 1 (CCRL1) is a late determinant of cortical thymic epithelial cell differentiation PMID:25070355
found that lymph node fringes indeed contained physiological gradients of the chemokine CCL21, which depended on the expression of CCRL1, the atypical receptor for the CCR7 ligands CCL19 and CCL21 PMID:24813163
CCX-CKR deletion increases incidence of a spontaneous Sjogren's syndrome-like pathology, suggestive of a defect in self-tolerance. CCX-CKR(-/-) mice have fewer thymic epithelial cells per thymocyte, with defects in thymocyte distribution & frequency. PMID:23152546
CCX-CKR(-/-) have a 5-fold increase in the level of CCL21 protein in blood, and 2- to 3-fold increases in CCL19 and CCL21 in peripheral lymph nodes. PMID:20562329
Characterization of mouse CCX-CKR, a receptor for the lymphocyte-attracting chemokines TECK/mCCL25, SLC/mCCL21 and MIP-3beta/mCCL19: comparison to human CCX-CKR. (CCX-CKR) PMID:11981810
These observations indicate that the silent chemokine receptor CCX-CKR1, regulates homeostatic leukocyte migration by controlling the availability of chemokines in the extracellular space. PMID:17485674