Home
Product
Protein
Transmembrane Proteins
Recombinant Mouse C-C chemokine receptor type 10 (Ccr10)

Recombinant Mouse C-C chemokine receptor type 10 (Ccr10)

Code: CSB-CF878098MO

Rate （N/A）
Review （0）

Size:

20μg100μg

US$5203

Quantity:

Express system: in vitro E.coli expression system

Species: Mus musculus (Mouse)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

Ccr10

Uniprot NO.

Q9JL21

Alternative Names

Ccr10; Cmkbr9; Gpr2; C-C chemokine receptor type 10; C-C CKR-10; CC-CKR-10; CCR-10; Chemokine C-C receptor 9; G-protein coupled receptor 2

Species

Mus musculus (Mouse)

Source

in vitro E.coli expression system

Expression Region

1-362

Target Protein Sequence

MGTKPTEQVSWGLYSGYDEEAYSVGPLPELCYKADVQAFSRAFQPSVSLMVAVLGLAGNG LVLATHLAARRTTRSPTSVHLLQLALADLLLALTLPFAAAGALQGWNLGSTTCRAISGLY SASFHAGFLFLACISADRYVAIARALPAGQRPSTPSRAHLVSVFVWLLSLFLALPALLFS RDGPREGQRRCRLIFPESLTQTVKGASAVAQVVLGFALPLGVMAACYALLGRTLLAARGP ERRRALRVVVALVVAFVVLQLPYSLALLLDTADLLAARERSCSSSKRKDLALLVTGGLTL VRCSLNPVLYAFLGLRFRRDLRRLLQGGGCSPKPNPRGRCPRRLRLSSCSAPTETHSLSW DN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Receptor for chemokines SCYA27 and SCYA28. Subsequently transduces a signal by increasing the intracellular calcium ions level.

Gene References into Functions

this study shows that losartan and dexamethasone may suppress inflammatory responses in IgA nephropathy by inhibiting CCR10 expression in Th22 cells PMID:27930971
controls innate and memory immune responses in the skin PMID:24767879
Our in vivo analysis demonstrated that uniform expression of Ccr10 on MSCs and alteration of Ccl27 level in the skin enhance extravasation of stem cells from circulation and facilitate their migration within cutaneous tissue PMID:23321329
These findings provide definite evidence that CCR10 is important in skin intraepithelial Vgamma3(+) T lymphocyte development PMID:20937851
Blocking CCR4 and CCR10 simultaneously, or their ligands, should be beneficial in the treatment of T-cell-mediated skin diseases. PMID:18095942
CCR10 is critical for efficient localization and accumulation of immunoglobulin A antibody-secreting cells to the lactating mammary gland. PMID:18941222