MEISDFTEAYPTTTEFDYGDSTPCQKTAVRAFGAGLLPPLYSLVFIIGVVGNVLVILVLMQHRRLQSMTSIYLFNLAVSDLVFLFTLPFWIDYKLKDDWIFGDAMCKLLSGFYYLGLYSEIFFIILLTIDRYLAIVHAVFALRARTVTFGIITSIITWALAILASMPALYFFKAQWEFTHRTCSPHFPYKSLKQWKRFQALKLNLLGLILPLLVMIICYAGIIRILLRRPSEKKVKAVRLIFAITLLFFLLWTPYNLSVFVSAFQDVLFTNQCEQSKQLDLAMQVTEVIAYTHCCVNPIIYVFVGERFWKYLRQLFQRHVAIPLAKWLPFLSVDQLERTSSISPSTGEHELSAGF
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length
Tag Info
C-terminal 10xHis-tagged If you have specified tag type, please tell us and we will check if it's possible to develop.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from PBS, 6% Trehalose, pH 7.4.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80°C. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing.
Receptor for a C-C type chemokine. Binds to MIP-1-alpha, RANTES, and less efficiently, to MIP-1-beta or MCP-1 and subsequently transduces a signal by increasing the intracellular calcium ions level. Responsible for affecting stem cell proliferation.
Gene References into Functions
CCL9 secreted by splenic macrophages induces a CCR1dependent accumulation of MDSCs.PMID:30365155
The enhanced presence of CCL3 can explain the immediate analgesic effects, independent from an anti-inflammatory action, evoked by the administration of the CCR1 antagonist J113863 in carrageenan- and complete Freund's adjuvant inflamed mice.PMID:26663750
Inhibition of CCR1, the distal part of this signaling relay, may have a therapeutic impact in metastatic disease with lower toxicity than blocking upstream targets.PMID:26122939
Data indicate that deletion or inhibition of CC chemokine receptor 1 (CCR1) decreases pain responses.PMID:25170619
CCR1-mediated accumulation of myeloid cells in the liver microenvironment promotes mouse colon cancer metastasis.PMID:25326065
CCR1 is required for recruitment of neutrophils during respiratory infection with modified vaccinia virus Ankara.PMID:25008920
This study demonstrates a Tpl2-dependent mechanism for macrophage expression of select chemokine receptors.PMID:24713702
Ccr1 plays a critical role in the recruitment of T and mononuclear phagocyte cells to inflamed kidneys of NZB/W mice, which in turn contribute to the progression of renal injury.PMID:24367031
CCR1.beta-arrestin-2 complex may be related to a potential scavenging function of the receptor, which may be important for maintenance of chemokine gradients and receptor responsiveness in complex fields of chemokines during inflammation.PMID:24056371
CCR1 expression by both hematopoietic and nonhematopoietic cells favors tumor aggressiveness and liver cancer metastasis development.PMID:23730212
findings show that CCR1 is pivotal for bone remodeling induced by mechanical loading during orthodontic tooth movement and these actions depend, at least in part, on CCL3PMID:23059626
neutrophil Ccr1 amplifies late renal immunopathology and increases mortality in invasive candidiasis by mediating excessive recruitment of neutrophils from the blood to the target organ.PMID:22916017
a bis-quinoline compound, (7-chloro-N-(4-(7-chloroquinolin-4-ylamino)butyl)quinolin-4-amine; RE-660) has C-C chemokine receptor type 1 (CCR1)-agonistic propertiesPMID:22104149
CCR1 functions within the glioblastoma microenvironment through CCR1 and CCR5 in a redundant manner.PMID:22425022
The selective interaction of CCL3 with its receptor, CCR1, is critical for radiation-induced lung inflammation and fibrosis, and these conditions can be largely prevented by a small molecule inhibitor of CCR1PMID:20870892
chemokine receptors CCR1, CCR2 and CCR4 have roles in the pathogenesis of experimental dengue infection in micePMID:21206747
Data suggest that the CCR1 receptor has a key role in the pathogenesis of smoke-induced inflammation.PMID:20387089
These results suggest that peripheral nerve injury elicits the up-regulation of spinal MIP-1alpha and CCR1 to participate in neuropathic pain.PMID:20692319
the axis of CCR1 and its ligands are likely to be involved in cross-talk between osteoclasts and osteoblasts by modulating the RANK-RANKL-mediated interaction.PMID:20571024
Lack of the Ccr1, Mmp2, or Mmp9 gene in the host dramatically suppresses outgrowths of disseminated tumors in the liver.PMID:20616008
Overexpression of CCR1 enhances transplanted mesenchymal stem cell survival, migration, and engraftment in ischemic myocardium.PMID:20378860
Mast cells produce intercellular connections and that mediators are directionally released upon co-stimulation of FcepsilonRI and CCR1.PMID:20173038
Results reveal the potential involvement of CCL9 and CCR1 in macrophage and microglial cells by CpG-ODNs and may help understanding the role of the chemokine/chemokine receptor pairs in macrophage/microglia under physiologic and pathologic conditions.PMID:19883904
CCL9 and its receptor CCR1 are the major chemokine and receptor species expressed by osteoclastsPMID:12397598
CCR1 exacerbates L. major infection in C57BL/6 mice by up-regulating Th2-like response rather than inhibiting Th1 development or/and influencing leucocyte chemotaxisPMID:12631234
Signaling via CCR1 is critical in the pathogenesis of the IL-13-induced inflammatory pulmonary phenotype.PMID:14734772
CCR1 plays a significant role in the development of chronic heart graft rejection.PMID:14757698
Ccr1 is essential for establishment of an efficient antiviral response during a systemic HSV-2 infection.PMID:15030585
CCR1 has a role in progression of experimental lupus nephritisPMID:15153561
CCR1 chemokines may stimulate the chemotactic recruitment and RANKL formation of bone-resorptive osteoclasts and have a role in skeletal diseasesPMID:15537451
While dispensable for leukocyte recruitment during sepsis, CCR1 is a pivotal focus of host immune response to sepsis that triggers unregulated expression of proinflammatory cytokines resulting in increased injury and mortality.PMID:15557190
CCR1-mediated recruitment and local activation of macrophages contribute to disease progression in COL4A3-deficient mice. CCR1 is potential therapeutic target for Alport disease or other progressive nephropathies with interstitial macrophage infiltrates.PMID:15716328
Neutrophil migration observed in this model of immune inflammation is mediated by MIP-1alpha[CCL3], which via CCR1, induces the sequential release of TNF-alpha and LTB(4).PMID:15831559
Rac activation is critical for both CCR1- and CCR5-triggered signaling cascades mediating beta-chemokine-induced reorganization of the actin cytoskeletonPMID:15882964
Chemokine receptor CCR1 has functions for leukocyte adhesion to vascular endothelium and for transendothelial diapedesis. CCR1 blockade can improve injury in progressive kidney disease models, even in advanced disease states.PMID:16088077
observations suggest the contribution of the CCR1-CCL3 axis to hepatocellular carcinoma progressionPMID:16284949
CCR1 signaling cascade is under the control of NFAT2 and seems to enhance the migration of differentiating osteoclastsPMID:16355273
CCR1 may be a potential target during detrimental pulmonary responses during infectionPMID:16456018
proinflammatory interferon gamma was increased in the neointima of CCR1(-/-) mice, and its blockade unmasked a reduction in macrophage recruitmentPMID:16467202
Alters the immuno-inflammatory response in atherosclerosis and prevents excessive plaque growth and inflammation.PMID:16491201
analysis of CCR1 chemokine receptor structure and BX 471 antagonist binding followed by experimental validationPMID:16837468
CCR1 plays a role in osteolysis and angiogenesis in multiple myeloma. It affects myeloma cells and stromal cells.PMID:17086356
Lack of CCR1 prevents accumulation of CD34(+) iMCs at the invasion front and suppresses tumor invasion.PMID:17369830
Substance P stimulates expression of neutrophil CCR1 via neurokinin-1 receptor and nuclear factor kappa B activation.PMID:17494633
Ccr1 deficiency reduces inflammatory remodelling and preserves left ventricular function after myocardial infarction.PMID:18088392
No increase in mortality was observed during the acute phase of disease following MHV infection of mice lacking CCR1 (CCR1-/-) as compared to wild-type (CCR1+/+) mice.PMID:18158733
identify CCR1 as a potential target for alleviating T-cell accumulation during exacerbation of asthmatic disease.PMID:18202190
CCR1 and CCR5 and their ligand CCL3 play a crucial role in the regulation of intratumoral dendritic cell accumulation and the subsequent establishment of tumor immunity following induction of tumor apoptosis by suicide genes.PMID:18644849
In a model of renal ischemia-reperfusion injury, CCR1 is an important factor promoting infiltration by neutrophils and macrophages; however, this activity does not appear to affect tissue injury.PMID:19050287
Show
More
Hide
All
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Detected in the heart, spleen, lung, peritoneal exudate cells and leukocytes.