Home
Product
Protein
Transmembrane Proteins
Recombinant Mouse C-C chemokine receptor-like 2 (Ccrl2)

Recombinant Mouse C-C chemokine receptor-like 2 (Ccrl2)

Code: CSB-CF004852MO

Rate （N/A）
Review （0）

Size:

20μg100μg

US$5188

Quantity:

Express system: in vitro E.coli expression system

Species: Mus musculus (Mouse)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

Ccrl2

Uniprot NO.

O35457

Alternative Names

Ccrl2; Ccr11; Lccr; C-C chemokine receptor-like 2; Chemokine receptor CCR11; G-protein coupled beta chemokine receptor; Lipopolysaccharide-inducible C-C chemokine receptor; L-CCR

Species

Mus musculus (Mouse)

Source

in vitro E.coli expression system

Expression Region

1-360

Target Protein Sequence

MDNYTVAPDDEYDVLILDDYLDNSGPDQVPAPEFLSPQQVLQFCCAVFAVGLLDNVLAVF ILVKYKGLKNLGNIYFLNLALSNLCFLLPLPFWAHTAAHGESPGNGTCKVLVGLHSSGLY SEVFSNILLLVQGYRVFSQGRLASIFTTVSCGIVACILAWAMATALSLPESVFYEPRMER QKHKCAFGKPHFLPIEAPLWKYVLTSKMIILVLAFPLLVFIICCRQLRRRQSFRERQYDL HKPALVITGVFLLMWAPYNTVLFLSAFQEHLSLQDEKSSYHLDASVQVTQLVATTHCCVN PLLYLLLDRKAFMRYLRSLFPRCNDIPYQSSGGYQQAPPREGHGRPIELYSNLHQRQDII
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

Full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Receptor for CCL19 and chemerin/RARRES2. Does not appear to be a signaling receptor, but may have a role in modulating chemokine-triggered immune responses by capturing and internalizing CCL19 or by presenting RARRES2 ligand to CMKLR1, a functional signaling receptor. Plays a critical role for the development of Th2 responses.

Gene References into Functions

Ccrl2 modulates chemerin levels in the epithelial lining fluid of the lungs but does not contribute to the development of O3-induced lung pathology. PMID:29242308
upregulation of CCRL2 observed under inflammatory conditions is functional to finely tune CXCR2-mediated neutrophil recruitment at sites of inflammation. PMID:28743719
chemokine (CC motif) receptor-like 2 should be considered to be a molecule involved in the regulation of the inflammatory response associated with multiple sclerosis. PMID:26744451
CCRL2 mRNA was not significantly changed in murine and human non-alcoholic steatohepatitis liver. CCRL2 was related to the mRNA levels of F4/80, transforming growth factor beta and alpha smooth muscle actin in murine non-alcoholic steatohepatitis. PMID:28600126
Proinflammatory stimuli upregulate atypical chemerin receptor CCRL2 and VCAM-1 on endothelial cells via NF-kappaB and JAK/STAT intracellular signaling pathways. PMID:22696441
Ccrl2(-/-) mice showed normal recruitment of circulating dendritic cells (DC) into the lung, but a defective trafficking of antigen-loaded lung DC to mediastinal lymph nodes. PMID:20606167
Expression of L-CCR mRNA is reported in murine astrocytes and microglia and is greatly enhanced under proinflammatory conditions; this receptor may play a role in neuroinflammatory processes. PMID:12555200
Prominent expression of L-CCR mRNA is detected in astrocytes and microglia at early time points throughout the brain and spinal cord in experimental autoimmune encephalomyelitis supporting the proposed relationship of L-CCR expression to CNS inflammation. PMID:14999816
Results identify chemerin as a natural nonsignaling protein ligand for both human and mouse CCRL2. PMID:18794339

Hide All

Subcellular Location

Cell membrane; Multi-pass membrane protein.

Protein Families

G-protein coupled receptor 1 family

Tissue Specificity

Expressed in macrophages, astrocytes, in glial cells. Constitutively expressed by mast cells. Detected in bronchial epithelium in OVA-induced airway inflammation. Up-regulated during dendritic cell (DC) maturation.

Database Links

UNIGENE: Mm.7336

KEGG: mmu:54199

STRING: 10090.ENSMUSP00000107519

Promotions