Home
Product
Protein
Transmembrane Proteins
Recombinant Mouse Bile acyl-CoA synthetase (Slc27a5)

Recombinant Mouse Bile acyl-CoA synthetase (Slc27a5)

Code: CSB-CF700008MO

Rate （N/A）
Review （0）

Size:

20μg100μg

US$7650

Quantity:

Express system: in vitro E.coli expression system

Species: Mus musculus (Mouse)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

Slc27a5

Uniprot NO.

Q4LDG0

Alternative Names

Slc27a5; Acsb; Acsvl6; Fatp5; Vlacsr; Bile acyl-CoA synthetase; BACS; Bile acid-CoA ligase; BA-CoA ligase; BAL; Cholate--CoA ligase; Fatty acid transport protein 5; FATP-5; Solute carrier family 27 member 5; Very long-chain acyl-CoA synthetase-related protein; VLACS-related; VLACSR

Species

Mus musculus (Mouse)

Source

in vitro E.coli expression system

Expression Region

1-689

Target Protein Sequence

MGIWKKLTLLLLLLLLVGLGQPPWPAAMALALRWFLGDPTCLVLLGLALLGRPWISSWMP HWLSLVGAALTLFLLPLQPPPGLRWLHKDVAFTFKMLFYGLKFRRRLNKHPPETFVDALE RQALAWPDRVALVCTGSEGSSITNSQLDARSCQAAWVLKAKLKDAVIQNTRDAAAILVLP SKTISALSVFLGLAKLGCPVAWINPHSRGMPLLHSVRSSGASVLIVDPDLQENLEEVLPK LLAENIHCFYLGHSSPTPGVEALGASLDAAPSDPVPASLRATIKWKSPAIFIFTSGTTGL PKPAILSHERVIQVSNVLSFCGCRADDVVYDVLPLYHTIGLVLGFLGCLQVGATCVLAPK FSASRFWAECRQHGVTVILYVGEILRYLCNVPEQPEDKIHTVRLAMGNGLRANVWKNFQQ RFGPIRIWEFYGSTEGNVGLMNYVGHCGAVGRTSCILRMLTPFELVQFDIETAEPLRDKQ GFCIPVEPGKPGLLLTKVRKNQPFLGYRGSQAESNRKLVANVRRVGDLYFNTGDVLTLDQ EGFFYFQDRLGDTFRWKGENVSTGEVECVLSSLDFLEEVNVYGVPVPGCEGKVGMAAVKL APGKTFDGQKLYQHVRSWLPAYATPHFIRIQDSLEITNTYKLVKSRLVREGFDVGIIADP LYILDNKAQTFRSLMPDVYQAVCEGTWNL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Acyl-CoA synthetase that catalyzes the activation of bile acids via formation of bile acid CoA thioesters which is necessary for their subsequent conjugation with glycine or taurine. Catalyzes the activation of the primary bile acid, cholic acid. Both primary bile acid (chenodeoxycholic acid) and secondary bile acids (deoxycholic acid and lithocholic acid) are the principal substrates. Also exhibits acyl CoA synthetase activity that activates very long-chain fatty acids (VLCFAs) by catalyzing the formation of fatty acyl-CoA. In vitro, also activates 3-alpha,7-alpha,12-alpha-trihydroxy-5- beta-cholestanate (THCA), the C27 precursor of cholic acid deriving from the de novo synthesis from cholesterol. Exhibits long-chain fatty acids (LCFA) transport activity. Plays an important role in hepatic fatty acid uptake and bile acid reconjugation and recycling but not in de novo synthesis of bile acids.

Gene References into Functions

Fatp5 knockdown lead to a 100-fold increase in ratio of unconjugated to conjugated bile acids in ApoB defficient mice PMID:21826528
Slc27a5, also known as fatty acid transport protein 5 (FATP5), is the hepatic BA-CoA ligase involved in reconjugating BAs during enterohepatic BA recycling PMID:21819150
Efficient hepatocellular uptake of long-chain fatty acids, and thus liver lipid homeostasis in general, is largely protein-mediated process requiring fatty acid transport protein 5 (FATP5). PMID:16618416
Important role for fatty acid transport protein 5(FATP5) in bile acid conjugation in vivo and an unexpected function in body weight homeostasis. PMID:16618417
continued activity of hepatic fatty acid transport protein 5 is required to sustain caloric uptake and fatty acid flux into the liver during high fat feeding PMID:18524776