Bcl2l1; Bcl2l; Bclx; Bcl-2-like protein 1; Bcl2-L-1; Apoptosis regulator Bcl-X
Species
Mus musculus (Mouse)
Source
in vitro E.coli expression system
Expression Region
1-233
Target Protein Sequence
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEETEAERETPSAINGNPSWHLA DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIASWMATYLNDHLEP WIQENGGWDTFVDLYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Potent inhibitor of cell death. Inhibits activation of caspases. Appears to regulate cell death by blocking the voltage-dependent anion channel (VDAC) by binding to it and preventing the release of the caspase activator, CYC1, from the mitochondrial membrane. Also acts as a regulator of G2 checkpoint and progression to cytokinesis during mitosis.; Isoform Bcl-X(L) also regulates presynaptic plasticity, including neurotransmitter release and recovery, number of axonal mitochondria as well as size and number of synaptic vesicle clusters. During synaptic stimulation, increases ATP availability from mitochondria through regulation of mitochondrial membrane ATP synthase F(1)F(0) activity and regulates endocytic vesicle retrieval in hippocampal neurons through association with DMN1L and stimulation of its GTPase activity in synaptic vesicles. May attenuate inflammation impairing NLRP1-inflammasome activation, hence CASP1 activation and IL1B release.; Isoform Bcl-X(S) promotes apoptosis.
Gene References into Functions
Depletion of miR-34a facilitated endothelial cell growth and blocked apoptosis in AS by upregulating Bcl-2, offering a promising avenue for AS therapy.PMID:29704100
BCL-XL promotes stemness and contributes to the aggressiveness of both melanoma and glioblastoma.PMID:29238043
targeting BCLxL in human and mouse synovial sarcoma with the small molecule BH3 domain inhibitor, BXI-72, achieved significant cytoreduction and increased apoptotic signaling.PMID:28851813
GATA-3 participates in the healing of bone fractures via regulating bcl-xL gene expression, owing to its association with Runx2.PMID:29170477
this study demonstrates that necrosis of Mycobacterium tuberculosis-infected macrophages is dependent on the action of Bcl-xlPMID:28401933
Mitochondrial Bcl-xL is involved in maintaining mitochondrial respiratory capacity. Its deficiency causes oxidative stress, which is associated with an increased glycolytic capacity and balanced by an increased activity of the pentose phosphate pathway.PMID:28807815
Proapoptotic proteins BIM and PUMA are not critical for the reticulocyte apoptosis caused by loss of the pro-survival protein BCL-XL.PMID:28682312
BMP4 promotes survival of neural stem/progenitor cells by enhancing the anti-apoptotic function of Bcl-xL via BMP4-Smad1/5/8-Id1 signaling in the presence of FGF-2.PMID:29353044
Bcl-xL is required for survival of post mitotic neurons throughout the developing spinal cord.PMID:27665712
Atherosclerosis-associated endothelial cell apoptosis may partially result from downregulation of Bcl-Xl, through upregulation of miR-876 that binds and suppresses translation of Bcl-Xl mRNA.PMID:28723693
Bcl-xL is a driver in colorectal tumorigenesis and cancer progression.PMID:27537525
These data show that Mcl-1 is dispensable for the regulation of apoptosis during infection with different large DNA viruses.Bcl-XL, on the other hand, can be important to maintain survival of virus-infected cellsPMID:27537523
BCL-XL expression promotes survival of immature B cells, expression of BCL-2 is important for survival of mature B cells and long-lived plasma cells (PC), and expression of MCL-1 is important for survival throughout B-cell development.PMID:27560714
Bcl-xL deficiency induced apoptosis in a select population of differentiated neurons and led to severe neurobehavioral abnormalities.PMID:27194326
loss of PUMA had no impact on the loss of platelets caused by loss of BCL-XL. It therefore remains to be established whether other BH3-only proteins play a critical role in induction of apoptosis in platelets or whether their death is controlled solely by the interactions between BCL-XL with BAK and BAX.PMID:27221652
MLF1 is negatively regulated by 14-3-3 via binding to, and blocking, MLF1's Bcl-2 homology domain 3 and thereby preventing Bcl-XL from associating with MLF1.PMID:26563351
Genetic and pharmacological inhibition of BCL-W and BCL-XL causes directed elimination of senescent cells.PMID:27048913
Valproic acid sensitized TRAIL-resistant papillary thyroid carcinoma cells to apoptotic cell death through involvement of Nrf2 and Bcl-xL.PMID:26721202
These findings indicate that eosinophil survival is largely regulated by betac chain-induced NF-kappaB activation and subsequent induction of Bcl-xPMID:25862560
these data indicate that beta-cell apoptosis is, in part, attributable to the modulation of 5'SS selection in the Bcl-x pre-mRNA by bioactive lipids modulated by iPLA2beta.PMID:25762722
only loss of both Bclx alleles markedly forestalled tumorigenesis, loss of a single Bim allele overcame this blockade.PMID:24858047
analysis of the role of BCL-XL or MCL-1 in the development and sustained growth of thymic lymphoma elicited by loss of p53 reveals that only MCL-1 is criticalPMID:25368374
cell death is C/EBP homologous protein (CHOP)-dependent, connecting these events to the UPR. Thus plasma cell differentiation proceeds through a Bcl-xL-dependent intermediate.PMID:25023286
These results demonstrate that Bcl-xL regulates CD1d-mediated Ag processing and presentation to NKT cells by altering the late endosomal compartment and changing the intracellular localization of CD1d.PMID:25070854
anti-apoptotic role of HAX-1 versus BCL-XL in cytokine-dependent bone marrow-derived cellsPMID:24910348
IL-33/ST2 axis promotes mast cell survival via BCLXL.PMID:24982172
PP6 activity is regulated to control apoptosis by modulating Ser(62) phosphorylation of Bcl-xL, which results in its polyubiquitination and degradation.PMID:24808369
signaling cassette identified in cardiac myocytes consisting of K-Ras, RASSF1A and Mst1 localized to mitochondria; promotes Mst1 activation in response to oxidative stress; activated Mst1 phosphorylates Bcl-xL antagonizing Bcl-xL-Bax binding causing activation of Bax and subsequent apoptosisPMID:24813943
A double-mutant knockin of the CD28 YMNM and PYAP motifs reveals a critical role for the YMNM motif in regulation of T cell proliferation and Bcl-xL expression.PMID:24639356
Instead, Bcl-xL -blocked apoptosis resulting from hypoxia and/or nutrient loss associated with the inhibition of angiogenesis caused by NK cell-secreted IFN-gammaPMID:24313893
identified inositol trisphosphate receptors as unique effectors of K-Ras4B that antagonize the prosurvival signals of other K-Ras effectors.PMID:24297914
Disruption of Bcl-xL:Bax binding caused rapid apoptosis of neural progenitors and medulloblastoma cells.PMID:24227720
Bcl-xL interacts functionally with VDAC1 and -3 but not VDAC2.PMID:23720737
Cleavage-resistant Bcl-2 and Bcl-xL are more efficient than their wild-type counterparts at inhibiting apoptosis in primary mouse T cells after T cell receptor cross-linking mechanisms.PMID:23203923
In steatotic hepatocytes, the lack of voltage-dependent anion channel phosphorylation is accompanied by a decrease of interaction with the serine/threonine glycogen synthase kinase 3 and Bcl-XL in mitochondria.PMID:22814966
Bcl-xL has crucial anti-apoptotic roles at multistages in the megakaryocytic lineage, making possible prevention of lethal or severe spontaneous hemorrhage.PMID:22790873
Hesperetin prevented the xenograft growth by down-regulating the expression of cyclin D1, CDK4 and Bcl-xL and up-regulating p57Kip2 expression in MCF-7 cells.PMID:22209285
Clusterin interacts with Bcl-xL in dying hippocampal CA3 neurons following seizures while the levels of Bcl-xL remain constant.PMID:22197644
BCL-X is required for survival of differentiating retinal ganglion cells.PMID:22836101
when localalized in the endoplasmic reticulum, Bcl-x(L) impinges on Ca(2+) homeostasis but does not affect apoptosis unless Bcl-x(L) is present in additional cellular compartments.PMID:22573883
Tanshinone IIA protected neurons against the Abeta-induced cytotoxicity most likely via activation of the Bcl-xL pathwayPMID:22498308
The combination of Bcl-x(L) and Mcl-1 is essential for the viability of the megakaryocyte lineage.PMID:22374700
Modulation of macrophage resistance to apoptosis through targeted deletion of Bcl-x has a major impact on the entire macrophage cell population in the bodyPMID:22383704
The Bcl-2 proteins Noxa and Bcl-xL co-ordinately regulate oxidative stress-induced apoptosis.PMID:22380599
Pathologic elevation of Bcl-x(L) may be the result of impaired adaptation, with implications for myeloproliferative disease mechanisms.PMID:22086418
Data show that Down syndrome model mice ehxibit downregulation of Bcl-X(L) in the hippocampus.PMID:21684326
Hematopoietic stem cells in patients with an Lnk/Sh2b3 mutation might become resistant to apoptosis due to thrombopoietin-mediated enhanced expression of Bcl-xL.PMID:22101255
Bcl-xL is required for lymphomagenesis in myc(-/-) transgenic mice, who constitutively overexpress c-Myc oncoprotein in B-lymphoid cells and develop pre-B and B-cell lymphomas; this is in contrast to Bcl-2 which is required.PMID:21998213
EVI1 directly induces the expression of Bcl-xL through the first set of zinc finger and thereby inhibits apoptosisPMID:21980434
Hrk deficiency does not significantly attenuate the widespread apoptosis seen in the Bcl-x (-/-) embryonic nervous system, indicating that other BH3-only molecules, alone or in combination, may regulate BAX activation in immature neurons.PMID:22043021
Widely expressed, with highest levels in the brain, thymus, bone marrow, and kidney. Bcl-X(L) and Bcl-X(delta-TM) expression is enhanced in B- and T-lymphocytes that have been activated.