Bak1; Bak; Bcl-2 homologous antagonist/killer; Apoptosis regulator BAK
Species
Mus musculus (Mouse)
Source
in vitro E.coli expression system
Expression Region
2-209aa
Target Protein Sequence
ASGQGPGPPKVGCDESPSPSEQQVAQDTEEVFRSYVFYLHQQEQETQGAAAPANPEMDNLPLEPNSILGQVGRQLALIGDDINRRYDTEFQNLLEQLQPTAGNAYELFTKIASSLFKSGISWGRVVALLGFGYRLALYVYQRGLTGFLGQVTCFLADIILHHYIARWIAQRGGWVAALNFRRDPILTVMVIFGVVLLGQFVVHRFFRS
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
In the presence of an appropriate stimulus, accelerates programmed cell death by binding to, and antagonizing the anti-apoptotic action of BCL2.
Gene References into Functions
It was shown that double knockout of Bax and Bak from proximal tubules attenuated renal tubular cell apoptosis and suppressed renal interstitial fibrosis in UUO.PMID:28317867
Study reports the proximal alpha1-alpha2 loop as a second activation site in Bak and in mitochondrial Bax.PMID:27217060
Here the authors show that mouse embryonic fibroblasts deficient in Bax/Bak1 are resistant to the third major form of cell death associated with autophagy through a mechanism involving lysosome permeability.PMID:29148970
BH3-only proteins bind inactive full-length BAK at mitochondria and then dissociate following exposure of the BAK BH3 and BH4 domains before BAK homodimerizationPMID:28673969
Resultdetermined the mouse Bak BH3-in-groove homodimers (BGH) structure, which allowed more accurate modeling within and between the BGHs. The BGHs were shown to oligomerize via the 'alpha 3/alpha 5 interface' in mitochondria. These findings suggest for a probable assembly of the Bak homodimers in the mitochondrial apoptotic pore.PMID:27488021
We propose that the GC-induced mitochondrial accumulation of Bax and the interaction between the GR and Bim, Bcl-xL and Bak could play a role in the regulation of thymocyte apoptosis.PMID:27888447
Conversion of Bim-BH3 from Activator to Inhibitor of Bak through Structure-Based Design.PMID:29149594
Postnatal synaptic rearrangement needed for acquisition of skilled behaviors requires the activity-dependent, non-apoptotic Bax/Bak-caspase signaling cascade. Adult Bax/Bak mutant mice exhibit aberrant co-activation of antagonistic muscle pairs and skilled grasping deficits but normal reaching and retrieval behaviors.PMID:28472660
The authors show that Bak is activated and that activated Bak is bound to p53 during reovirus encephalitis.PMID:27307572
Pancreatic beta-Cell Death due to Pdx-1 Deficiency Requires Multi-BH Domain Protein Bax but Not Bak.PMID:27137932
lipid profile in the absence of the proapoptotic proteins BAX and BAK in mouse embryonic fibroblastsPMID:26059977
alpha1 dissociation is a key step in unfolding Bak into three major components, the N terminus, the core (alpha2-alpha5) and the latch (alpha6-alpha8) that is required for apoptosis.PMID:25880232
BAX and BAK have a nonapoptotic role in eicosanoid metabolism in inflammation.PMID:25815636
Puma is the major mediator of virus-induced Bax/Bak activation and mitochondrial membrane permeabilization induction.PMID:26030884
Motifs of VDAC2 required for mitochondrial Bak import and tBid-induced apoptosis.PMID:26417093
dual ablation of Bax and Bak suppressed ureteral obstruction induced inflammation and kidney fibrosis with decreased tubular cell cycle arrestPMID:26180237
bak therefore regulates gastric epithelial cell apoptosis, proliferation, differentiation, mucosal thickness, and susceptibility to gastric atrophy and dysplasia following H. felis infectionPMID:26159699
Benzo(a)pyrene-7,8-diol-9,10-epoxide induced p53-independent necrosis via the mitochondria-associated pathway involving Bax and Bak activationPMID:24837741
MCL1, but not that of BAK, forms stable heterodimeric complexes with cBID in a manner adjustable by membrane cardiolipin content and curvature degree.PMID:25987560
data predict that the MPTP is an inner membrane regulated process, although in the absence of Bax/Bak the outer membrane resists swelling and prevents organelle rupture to prevent cell deathPMID:23991283
Abeta oligomers bind to BAK on the membrane and induce apoptotic BAK pores and cytochrome c releasePMID:25296312
results suggest that both of PDI and PDIA3 possess Bak-dependent proapoptotic function through inducing mitochondrial outer membrane permeabilization, which provides a new mechanism linking ER chaperone proteins and apoptotic signalingPMID:25697356
Platelet life span was found to be elevated in vavP-BCL-2 mice, which should have provoked thrombocytosis, as in Bak(-/-) mice.PMID:24464220
The ATF3 lies downstream of JNK signaling after TLR engagement, resulting in repression of pro-apoptotic Bak and Bax transcription.PMID:23697557
Data indicate that the antiapoptotic Bcl-2 family members do not directly inhibit components of the autophagic pathway but instead affect autophagy indirectly, owing to their inhibition of Bax and Bak.PMID:24912196
Gene-knockout studies support a critical role of Bax and Bak in tubular cell apoptosis in ischemic acute kidney injury.PMID:23466994
The results provide further insights into the organization of the BAK oligomeric pores by the BAK homodimers during mitochondrial apoptosis, enabling the proposal of a BAK-induced lipidic pore with the topography of a "worm hole."PMID:24337568
these results provide strong evidence that Puma, like Bim, Noxa, and tBid, is able to act as a direct Bak activator.PMID:24265320
N-Bak mRNA is translationally repressed by multiple mechanisms.PMID:23969856
Data indicate that Mcl-1 deficient embryonic fibroblasts (MEFs) reliant only on Bcl-XL for survival, and Bax/Bak deficient MEFs support a mechanism-based induction of apoptosis.PMID:23767404
Combined loss of BOK and BAK does not elicit any noticeable defects, although it remains possible that BOK and BAK have critical roles in developmental cell death.PMID:23744350
Bak apoptotic pore forms by the multimerization of BH3:groove homodimers and reveals that Bak alpha6 is not only important for Bak oligomerization and function but may also be involved in how Bak is activated by BH3-only proteins.PMID:23893415
role of BAX/BAK in long-term regulation of Nestin-positive progenitor cell pools, with loss of function predisposing to adult-onset tumorigenesis.PMID:22986529
Altered mitochondrial morphology and defective protein import in Bax/Bak-deficient mice reveal novel roles for Bax and/or Bak in the skeletal muscle.PMID:23784543
Murine cytomegalovirus-mediated inhibition of the pro-apoptotic Bak protein is required for optimal in vivo replication.PMID:23468630
Demonstrate that P2Y(12) activation protects platelets from apoptosis via PI3k-dependent Bak/Bax inactivation.PMID:23140172
activation of both BAK and BAX is initiated by direct BH3-interaction but at distinct trigger sites.PMID:23404709
Bak plays a critical role while Bax has an ancillary role in safeguarding immunological tolerance and prevention of autoimmune disease.PMID:23349374
The p53-Bak apoptotic signaling axis plays an essential role in regulating lens differentiation.PMID:22671997
BAX/BAK-independent cell death did not require Cyclophilin D (CypD) expression, an important regulator of the mitochondrial permeability transition porePMID:22719850
Deletion of Bak significantly inhibited hepatocyte apoptosis in Mcl-1 KO mice and reduced the incidence of liver cancer.PMID:22414765
This study showed that denervation-induced muscle disuse activates both apoptotic and autophagic signaling pathways in muscle, and autophagic protein expression does not exhibit a compensatory increase in the presence of attenuated apoptosis.PMID:22673615
Withanolide D elicits apoptosis in malignant cells through Bax/Bak dependent pathway in p53-wild type cells, whereas Bak compensates against loss of Bax in p53-null cellsPMID:22479585
Results indicate that a protective role for Bak during ionophore-induced cell death may be closely associated with its regulatory effect on maintenance of autophagic flux and vacuole homeostasis.PMID:22493436
Bax and Bak are functionally redundant, but they are counteracted by distinct anti-apoptotic Bcl-2 family proteins in different speciesPMID:22056880
the differential regulation of Bak and Bax by Mcl-1 is predominantly independent of the initial subcellular localizations of Bak and Bax.PMID:22442658
There is strong translational arrest of N-Bak mRNA in the neurons. This arrest is partially mediated by 50-untranslated region of Bak mRNA and it is not released during mitochondrial apoptosis.PMID:22297299
Data suggest that endoplasmic reticulum-localized Bcl2 protects against a Bax/Bak-independent cell death pathway initiated by the p20 fragment of Bap31.PMID:22197342
Studies suggest that BAK/BAX activation and apoptosis are coordinated through BH3-only proteins and a specific lipid milieu that is maintained by heterotypic membrane-mitochondrial interactions.PMID:22385963
Either Bak or Bax is critically required for rapid execution of Fas-mediated massive apoptosis in the liver, delayed onset of mitochondria-independent, caspase-dependent apoptosis develops even in the absence of both.PMID:21425311