Recombinant Mouse Basigin (Bsg)

Code: CSB-CF002831MO
Size:
20μg
20μg100μg
US$5248
Quantity:
Express system: in vitro E.coli expression system
Species: Mus musculus (Mouse)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
Bsg
Uniprot NO.
Alternative Names
Bsg; Basigin; Basic immunoglobulin superfamily; HT7 antigen; Membrane glycoprotein gp42; CD antigen CD147
Species
Mus musculus (Mouse)
Source
in vitro E.coli expression system
Expression Region
22-389
Target Protein Sequence
AAGFLKAPLSQERWAGGSVVLHCEAVGSPIPEIQWWFEGNAPNDSCSQLWDGARLDRVHIHAAYRQHAASSLSVDGLTAEDTGTYECRASSDPDRNHLTRPPRVKWVRAQASVVVLEPGTIQTSVQEVNSKTQLTCSLNSSGVDIVGHRWMRGGKVLQEDTLPDLHTKYIVDADDRSGEYSCIFLPEPVGRSEINVEGPPRIKVGKKSEHSSEGELAKLVCKSDASYPPITDWFWFKTSDTGEEEAITNSTEANGKYVVVSTPEKSQLTISNLDVNVDPGTYVCNATNAQGTTRETISLRVRSRMAALWPFLGIVAEVLVLVTIIFIYEKRRKPDQTLDEDDPGAAPLKGSGTHMNDKDKNVRQRNAT
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Essential for normal retinal maturation and development. Acts as a retinal cell surface receptor for NXNL1 and plays an important role in NXNL1-mediated survival of retinal cone photoreceptors. In association with glucose transporter SLC16A1/GLUT1 and NXNL1, promotes retinal cone survival by enhancing aerobic glycolysis and accelerating the entry of glucose into photoreceptors.; Signaling receptor for cyclophilins, essential for PPIA/CYPA and PPIB/CYPB-dependent signaling related to chemotaxis and adhesion of immune cells. Plays an important role in targeting the monocarboxylate transporters SLC16A1/GLUT1, SLC16A3 and SLC16A8 to the plasma membrane. Acts as a coreceptor for vascular endothelial growth factor receptor 2 (KDR/VEGFR2) in endothelial cells enhancing its VEGFA-mediated activation and downstream signaling. Promotes angiogenesis through EPAS1/HIF2A-mediated up-regulation of VEGFA and KDR/VEGFR2 in endothelial cells. Plays an important role in spermatogenesis; mediates interactions between germ cells and Sertoli cell and is essential for the development/differentiation of germ cells to round spermatids.
Gene References into Functions
  1. ectopic CD147-polarized distribution on basolateral membrane promotes hepatocyte depolarization by activation of the CD147-integrin alpha5beta1-E-cadherin ubiquitination-partitioning defective 3 decrease and beta-catenin translocation signaling cascade, replenishing a molecular pathway in hepatic carcinogenesis PMID:29356040
  2. CD147 deletion in hepatic stellate cells alleviated CCl4-induced liver fibrosis and inhibited HSCs activation. Overexpression of CD147 upregulated the secretion of CXCL1. PMID:29642635
  3. A new molecular mechanism for high angiogenic capacity, whereby microglia cells release basigin via up-regulation of PI3K-AKT and IGF-1 pathway to induce angiogenesis is unveiled. PMID:28661035
  4. EMMPRIN inhibited bFGF-induced IL-6 secretion by reducing the p65 subunit phosphorylation, it might be concluded that bFGF and EMMPRIN crosstalk in their respective signaling pathways. PMID:29104472
  5. protein-protein interaction studies on TRAF6 and BSG to get molecular level insights of the reactions. PMID:28612997
  6. This study has highlighted basigin as a common essential molecule for various stimuli-induced impairment of retinal vascular barrier, which can be a target for strategies to establish a curative treatment of diabetic retinopathy PMID:27917946
  7. Deletion of N-linked glycosylation at Asn152 on CD147 significantly suppressed in situ tumor metastasis in hepatocellular carcinoma. PMID:27869218
  8. MCT1 and Basigin variant-2, but not Basigin variant-1, are expressed within the mouse pineal gland. PMID:27815658
  9. this study provided a new mechanistic concept that CD147 can be a target for lymphocyte lineage reprogramming. PMID:28571672
  10. these results suggested that CD147 plays a key role in reducing extrinsic apoptosis in spermatocytes, but not spermatogonia, through modulating NFkappaB signaling pathway. PMID:27902973
  11. results establish neuroplastin and basigin as obligatory auxiliary subunits of native Plasma Membrane Calcium Atpases and key regulators of intracellular Ca2+ concentration. PMID:29056295
  12. Data show that caveolin-3 binds to low glycosylated extracellular matrix metalloproteinase inducer (LG-EMMPRIN) in cardiac cells and in the hearts of healthy mice. PMID:27649573
  13. These results suggest that basigin has a functional role as a binding partner with MCT2 in testicular and epididymal spermatozoa. PMID:26208397
  14. both caveolin-1 and EMMPRIN mRNA levels increased gradually with progression of developmental stages, and peaked at day two postnatal. The current finding suggests that both caveolin-1 and EMMPRIN take part in mouse tooth development, especially in the differentiation and organization of odontogenic tissues. PMID:27075451
  15. knockdown of CD147 on Hepa1-6 cells resulted in significantly increased T cells chemotaxis induced by CypA both in vivo and in vitro. PMID:27133068
  16. These findings indicate that TGF-beta1-CD147 loop plays a key role in regulating the HSC activation and combination of TGF-beta receptor inhibitor and anti-CD147 antibody might be promised to reverse fibrogenesis. PMID:26559755
  17. Decreased CD147 expression inhibited osteoclast formation and bone resorption, inhibited RANKL-induced nuclear translocation of the nuclear factor of activated T cells NFATc1. PMID:27038546
  18. EMMPRIN promotes tumor growth and metastasis by recruitment of bone marrow-derived cells through controlling secretion and paracrine signaling of SDF-1 and VEGF. PMID:26416452
  19. Results indicate the crucial roles of intracellular and extracellular Bsg in the pathogenesis of cardiac hypertrophy, fibrosis, and failure. PMID:26916734
  20. Disruption of BASIGIN in tumour cells and in MEFs has no action on the production of MMPs. PMID:26284589
  21. Extracellular CyPA activates platelets via cluster of differentiation 147-mediated phosphoinositid-3-kinase/Akt-signaling, leading to enhanced adhesion and thrombus formation independently of intracellular CyPA PMID:25550208
  22. Deletion of extracellular matrix metalloproteinase inducer/CD147 induces altered cardiac extracellular matrix remodeling in aging mice PMID:26084217
  23. Bsg plays an indispensable role in Th17 cell differentiation as a negative regulator by suppressing the IL-6/STAT-3 pathway. PMID:25891969
  24. may promote liver fibrosis progression via inducing the VEGF-A/VEGFR-2 signalling pathway-mediated cross-talk between hepatocytes and sinusoidal endothelial cells PMID:26201021
  25. our results demonstrated that CD147 was upregulated in the liver parenchymal and mesenchymal cells and involved in angiogenesis and tumor cell proliferation in the development of DEN/PB-induced HCC. PMID:25447507
  26. The current results illustrate that EMMPRIN may play a critical role in the processing and maturation of the dental matrix. PMID:25501684
  27. EMMPRIN ensures proper actomyosin-driven maturation of competent endothelial junctions by forming a molecular complex with gamma-catenin (also known as junction plakoglobin) and Nm23 (also known as NME1), a nucleoside diphosphate kinase PMID:24994937
  28. Taken together, these results indicate that CD147 promotes lung cancer-induced osteoclastogenesis by modulating IL-8 secretion, and suggest that CD147 is a potential therapeutic target for cancer-associated bone resorption in lung cancer patients. PMID:25661002
  29. EMMPRIN is involved in the epithelial-mesenchymal cross-talk during tooth development. PMID:24970041
  30. Data indicate that basigin (Bsg) is crucial for vascular smooth muscle cell (VSMC) proliferation. PMID:25149188
  31. Enhancement of CD147 on M1 macrophages induces differentiation of Th17 cells in the lung interstitial fibrosis. PMID:24932516
  32. study provided the first in vivo evidence for the function of basigin in thymus development PMID:24391450
  33. EMMPRIN antibody intervention ameliorates atherosclerosis by down-regulation of metalloproteinase activity in ApoE knockout mice. PMID:23642811
  34. results suggest that a reduction in mitochondria is a result, rather than the cause, of the metabolic deficiency observed in Basigin-null mice, and likely occurs because of reduced metabolic activity in the absence of MCT1 expression. PMID:23906756
  35. BSG-mediated germ cell-Sertoli cell interactions appear to be necessary for integrity of the blood-testis barrier and spermatocyte progression to mature spermatozoa. PMID:23727514
  36. CD147 is associated with assembly of numerous pro-oncogenic proteins in the plasma membrane and may play a fundamental role in properties characteristic of cancer stem-like cells. PMID:23178078
  37. A novel anti-EMMPRIN monoclonal antibody that blocks several aspects of T cell activity, thus highlighting the multiple roles of EMMPRIN in T cell biology in a model of multiple sclerosis. PMID:22480370
  38. N-acetylglucosaminyltransferase IVa regulates metastatic potential of mouse hepatocarcinoma cells through glycosylation of CD147. PMID:22736280
  39. observed that CD147 promoted tumor growth, inhibited tumor cell apoptosis and enhanced their invasion ability under hypoxia PMID:22678117
  40. demonstrated that immunodepletion of CD147 induces p53-independent apoptosis in mouse spermatocytes but not spermatogonia. PMID:22451502
  41. CD147 induces up-regulation of VEGF and HIF-1alpha in rheumatoid arthritis synoviocytes, further promotes angiogenesis, and leads to the persistence of synovitis. PMID:22170561
  42. Ang II up-regulated EMMPRIN expression in atherosclerotic plaque via AT1R. PMID:22020146
  43. Data suggest that basigin interacts with MCT1 and MCT2 to locate them properly in the membrane of spermatogenic cells and that this may enable sperm to utilize lactate as an energy substrate contributing to cell survival. PMID:21792931
  44. Steroid hormone-regulated let-7b mediates cell proliferation and basigin expression in the mouse endometrium. PMID:21747213
  45. Administration of anti-EMMPRIN neutralizing antibodies partly reduced the excess heart damage and MMP-9 expression induced by I/R in iNOS null mice, indicating that regulation of EMMPRIN is an important mechanism of NO-mediated cardioprotection PMID:21570464
  46. CD147 and MMP-2 were co-localized in spermatogonia, spermatocytes and round spermatids in mouse testis, while in human testis, they were co-localized in spermatocytes and round spermatids. PMID:21343160
  47. EMMPRIN supports platelet-monocyte interactions and promotes monocyte recruitment to the arterial wall PMID:21320284
  48. The MAPK signaling pathway is a potential key intracellular modulator of Ang II-induced increase in MMP-2 activity and MMP-14 and BSG protein expression. PMID:21641389
  49. treatment with cyclophilin A induced monocyte chemotaxis in a CD147- and phosphatidylinositol 3-kinase-dependent manner PMID:21441138
  50. Basigin is a key regulator of renal fibrosis. PMID:21281789

Show More

Hide All

Subcellular Location
[Isoform 1]: Cell membrane; Single-pass type I membrane protein. Photoreceptor inner segment. Cell projection, cilium, photoreceptor outer segment.; [Isoform 2]: Cell membrane; Single-pass type I membrane protein. Endoplasmic reticulum membrane; Single-pass type I membrane protein. Basolateral cell membrane; Single-pass type I membrane protein.
Tissue Specificity
[Isoform 1]: Retina-specific. Expressed in both rods and cones (at protein level).; [Isoform 2]: Testis and caput, corpus and cauda epididymides (at protein level). Expressed in the brain, lung, liver, kidney, heart, spleen, uterus, retina and skeletal mu
Database Links

UNIGENE: Mm.726

KEGG: mmu:12215

STRING: 10090.ENSMUSP00000070751

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products