MASQASLKLQPSNQSQQAPPNITSCEGAPEAWDLLCRVLPGFVITVCFFGLLGNLLVLSF FLLPWRRWWQQRRQRLTIAEIYLANLAASDLVFVLGLPFWAENVGNRFNWPFGSDLCRVV SGVIKANLFISIFLVVAISQDRYRLLVYPMTSWGNRRRRQAQVTCLLIWVAGGLLSTPTF LLRSVKVVPDLNISACILLFPHEAWHFVRMVELNVLGFLLPLAAILYFNFHILASLRGQK EASRTRCGGPKDSKTMGLILTLVASFLVCWAPYHFFAFLDFLVQVRVIQDCFWKELTDLG LQLANFFAFVNSCLNPLIYVFAGRLFKTRVLGTL
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
This is a receptor for bradykinin. Could be a factor in chronic pain and inflammation.
Gene References into Functions
study revealed that TRPA1 positively modulates the mechanical hyperalgesia induced by B1 receptor activation in the spinal cord and that the classical GPCR downstream moleculesPMID:27823962
Host kinin B1 receptor plays a protective role against melanoma progression.PMID:26898917
Studied nitric oxide (NO) release, L-arginine (L-Arg) uptake and the expression of the cationic amino acid transporter (CAT) -1 in endothelial cells obtained from B1 receptor knockout (B1-/-) and wild type (WT) mice.PMID:26446563
Kinin B1R contributes to acute gouty attacks, including the ones facilitated by ACEi.PMID:25344431
Kinin B1 receptor deletion affects bone healing in type 1 diabetic mice with femoral defects.PMID:25969420
Kinin B1 receptor deficiency or antagonism diminishes apoptosis caused by cisplatin.PMID:24357263
investigated if expression of B1 and B2 kinin receptors can be affected by IL-4 and IL-13; data show, for the first time, that IL-4 and IL-13 decrease kinin receptors in a STAT6-dependent mechanismPMID:23351078
Bradykinin plays an important role in the pathogenesis of anti-collagen antibody-induced arthritis (CAIA). Bradykinin receptor beta 1, whose expression is induced in inflamed joint tissue, is important in the development of CAIA.PMID:24599920
B(1) receptor deficiency altered plasma oxidant/antioxidant balance and induced moderate left ventricular dysfunction.PMID:24020815
The kinin B1 receptor plays a significant role in the regulation of skeletal muscle proteolysis in the levator ani muscle atrophy model.PMID:24498923
Genetic deletion of kinin B1R attenuates cognitive deficits and blocks mRNA expression of IL-17 and IFN-gamma in mice subjected to autoimmune encephalitis.PMID:23777652
B1R activation plays an important role in limiting the accumulation of amyloid-beta peptides in Alzheimer disease-like brain.PMID:23470163
Bdkrb1 participates in pathogenesis of LIEP bone loss possibly through mechanisms that involve modulation of TH 17 response, thereby demonstrating its role in the development of periodontitis.PMID:23534940
Activation of the kinin B1 receptor attenuates melanoma tumor growth and metastasis.PMID:23691222
B1R and B2R receptors exert a critical role in the establishment of persistent hypersensitivity observed in an experimental autoimmune encephalomyelitis modelPMID:23454198
Lack of kinin B receptor potentiates leptin action in the liver.PMID:23385644
A loss of B1 receptors markedly exacerbates the severity of dextran sulfate sodium-induced colitis in mice, which may be associated with compensatory overexpression of B2 receptorsPMID:22889120
kinin B(1) receptor participates in the modulation of insulin action in adipocytes, contributing to systemic insulin sensitivity and predisposition to obesity.PMID:23024762
Data indicate that under normal sodium intake, epithelial Na(+) channel (ENaC) open probability (P(o)) was modestly elevated in bradykinin receptors B1R, B2R(-/-) mice.PMID:23033373
Data conclude that kinin B1 receptors are important for modulation of insulin secretion and for the preservation of normal glucose levels and hepatic functions in obese mice.PMID:22829877
In the absence of B2R, both B1R and AT2R play important compensatory roles in preventing deterioration of cardiac function and remodelling post-myocardial infarction.PMID:22849668
Inflammatory muscle pain involves a cascade of events that is dependent on the activation of PKC, p38 and JNK, and the synthesis of IL-1beta, TNF-alpha and IL-6 associated with the up-regulation of both B(1) and B(2) kinin receptors.PMID:22220695
B(1) and B(2) receptors play different roles in modulating bradykinin-induced itch-related behavior in complete Freund's adjuvant-inflamed mice.PMID:22378823
The B(1)R subtype, play a dual role in experimental autoimmune encephalomyelitis progression.PMID:22132157
Kinin receptor deficient mice (B, or B receptor knock-out and BB receptor, double knock-out) presented a significant reduction in paclitaxel-induced hypernociceptive responses.PMID:21470206
In knockout mice lacking both B1 and B2 kinin receptors baseline nociceptive responses to heat were unaltered, nocifensive responses to bradykinin are abolished, and acute acetic acid-induced visceral nociception is reduced by approximately 70%.PMID:22273860
Role of vascular Kinin B1 receptors in endothelial nitric oxide metabolismPMID:21704095
The treatment of Ehrlich tumor-bearing mice with R-954 during 10 days after tumor inoculation resulted in a significant reduction of ascitic volume which clearly suggested that the B1 receptors were involved in the growth of this invasive tumor.PMID:21835216
B1 and B2 kinin receptors participate in hyperproliferative and inflammatory skin processes in micePMID:21840178
Transplantation of wild-type bone marrow cells into irradiated bradykinin B1 receptor mutant mice restore arteriogenesis, whereas bone marrow chimeric mice show reduced arteriogenesis after femoral artery occlusion.PMID:21719759
Propose that bradykinin has a crucial role in the pathogenesis of focal and segmental glomerulosclerosis operating through bradykinin B1 receptor signaling.PMID:21412216
Data show involvement of kinin B1 receptors in depressive behavioral responses, in a process likely associated with microglial activation and TNFalpha production.PMID:21194425
These results implicate bradykinin acting through bradykinin B1 receptor, in the development of acute lung injury caused by lipopolysaccharide inhalation.PMID:20153312
Bradykinin and related peptides released from melanoma cells may cause spontaneous pain and allodynia in the melanoma-bearing paw, in which B(1) and B(2) receptors on primary afferent and melanoma cells may have different roles.PMID:19932979
The volume of the cortical lesions and neuronal damage at 24 h after injury in B1R(-/-) mice were significantly smaller than in wild-type controls (2.5+/-2.6 versus 11.5+/-3.9 mm(3), P<0.001).PMID:20197781
Complete loss of bradykinin signaling expression does not worsen cardiac function or increase myocardial fibrosis in diabetes.PMID:20501666
Severe inflammation characterizes rapidly progressive glomerulonephritides, and expression of the kinin B1 receptor (B1R) associates with inflammation.PMID:20448019
Kinins acting on both B(1) and B(2) receptors played a crucial role in controlling the pruriceptive signalling triggered by PAR-2 activation in mice.PMID:20067469
all of the detrimental phenotypes observed in Akita diabetes are enhanced by lack of both B1R and B2R, including albuminuria, glomerulosclerosis, mitochondrial DNA deletions, reduction of nerve conduction velocity and heat sensation, and bone mineral lossPMID:20479236
during the aging process, the B1 receptor could be involved in neurodegeneration and memory loss.PMID:20060587
Laminar shear stress is a major determinant of functional B1R expression in endothelium.PMID:19661485
bradykinin b1 receptor mRNA was upregulated up to four-fold 24 h after controlled cortical impactPMID:19773800
analysis of bradykinin B1 receptors in the mouse kidneyPMID:19581823
Specific B1 receptor activation causes translocation of the epsilon isoform of protein kinase C to the membrane of a small fraction of sensory neurones.PMID:15319421
involvement of BKB1-R in the development of diabetic hyperalgesia in streptozotocin-mice through activation of the nitric oxide, substance P and calcitonin gene-related peptide pathwaysPMID:15654512
Results confirm the crucial role of the bradykinin B1 receptor, upregulated alongside inflammatory diabetes, in the development of diabetes-induced hyperalgesia.PMID:15680494
Targeted deletion of B1 receptors did not aggravate remodeling after myocardial infarction, whereas blockade of B2 receptors in B1-/- mice exaggerated left ventricular dysfunction and remodeling.PMID:15699461
the structure was characterized and the molecular mechanism underlying its regulated expression was studied by isolation and analysis of the 5' flanking regionPMID:16006238
The participation of the pro-inflammatory cytokine TNFalpha in the functional up-regulation of B(1) receptors in the mouse paw is reported.PMID:16039549
Kinin-B1 receptor (kinin-B1R) in cardiac tissue is upregulated in heat stressed mice and downregulated in L-arg-administered micePMID:16205319