Home
Product
Protein
Transmembrane Proteins
Recombinant Mouse B-lymphocyte antigen CD20 (Ms4a1)

Recombinant Mouse B-lymphocyte antigen CD20 (Ms4a1)

Code: CSB-CF015007MO

Rate （N/A）
Review （0）

Size:

20μg100μg

US$4672

Quantity:

Express system: in vitro E.coli expression system

Species: Mus musculus (Mouse)

Tag Info: 10xHis-SUMO-tag

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

Ms4a1

Uniprot NO.

P19437

Species

Mus musculus (Mouse)

Source

in vitro E.coli expression system

Expression Region

1-291

Target Protein Sequence

MSGPFPAEPTKGPLAMQPAPKVNLKRTSSLVGPTQSFFMRESKALGAVQIMNGLFHITLG GLLMIPTGVFAPICLSVWYPLWGGIMYIISGSLLAAAAEKTSRKSLVKAKVIMSSLSLFA AISGIILSIMDILNMTLSHFLKMRRLELIQTSKPYVDIYDCEPSNSSEKNSPSTQYCNSI QSVFLGILSAMLISAFFQKLVTAGIVENEWKRMCTRSKSNVVLLSAGEKNEQTIKMKEEI IELSGVSSQPKNEEEIEIIPVQEEEEEEAEINFPAPPQEQESLPVENEIAP
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

Full length protein

Tag Info

10xHis-SUMO-tag
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

B-lymphocyte-specific membrane protein that plays a role in the regulation of cellular calcium influx necessary for the development, differentiation, and activation of B-lymphocytes. Functions as a store-operated calcium (SOC) channel component promoting calcium influx after activation by the B-cell receptor/BCR.

Gene References into Functions

Our findings indicate that anti-CD20-IFNalpha eradicates B-cell lymphoma by employing tumor cells as antigen-presenting cells to reactivate tumor-infiltrating CD8(+) T cells and synergizing with anti-PD-L1 treatment PMID:28533311
Galectin-1 has a role in driving lymphoma CD20 immunotherapy resistance in a mouse model PMID:26888257
Results indicate that an antigen-specific B cell response towards intracellular pathogens can be generated during anti-CD20 depletion therapy. PMID:26261496
this study demonstrates a role for CD20 in B cell activation and T-dependent humoral immunity. PMID:23966626
CD20 is required for store-operated calcium entry in C2C12 myoblasts. PMID:22982241
immunization of mice with the CD20 extracellular domain-6 using Freund's or QS-21 adjuvants was shown to exert significant biological effects in vivo with the pronounced depletion of splenic B cells. PMID:20189250
type I CD20 antibody cytotoxicity critically depends on Fc receptor ITAM signaling PMID:20354182
CD20 deficiency in humans results in impaired T cell-independent antibody responses. PMID:20038800
review of structure, function, tissue and cell distribution PMID:12144126
Anti-CD20 antibodies rapidly depleted the vast majority of circulating and tissue B cells in an isotype-restricted manner dependent on effector cell Fc receptor expression. PMID:15210744
expression in bacterial cells; isolation and biophysical and structural studies PMID:16285718
In mice treated with anti-CD20 mAb, development of arthritis was significantly reduced in comparison to control mAb-treated mice PMID:18354225
involvement of CD20 in calcium influx PMID:18474602