Home
Product
Protein
Transmembrane Proteins
Recombinant Mouse B-cell antigen receptor complex-associated protein beta chain (Cd79b)

Recombinant Mouse B-cell antigen receptor complex-associated protein beta chain (Cd79b)

Code: CSB-CF004958MO

Rate （N/A）
Review （0）

Size:

20μg100μg

US$4013

Quantity:

Express system: in vitro E.coli expression system

Species: Mus musculus (Mouse)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

Cd79b

Uniprot NO.

P15530

Species

Mus musculus (Mouse)

Source

in vitro E.coli expression system

Expression Region

26-228

Target Protein Sequence

VPAMTSSDLPLNFQGSPCSQIWQHPRFAAKKRSSMVKFHCYTNHSGALTWFRKRGSQQPQELVSEEGRIVQTQNGSVYTLTIQNIQYEDNGIYFCKQKCDSANHNVTDSCGTELLVLGFSTLDQLKRRNTLKDGIILIQTLLIILFIIVPIFLLLDKDDGKAGMEEDHTYEGLNIDQTATYEDIVTLRTGEVKWSVGEHPGQE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Required in cooperation with CD79A for initiation of the signal transduction cascade activated by the B-cell antigen receptor complex (BCR) which leads to internalization of the complex, trafficking to late endosomes and antigen presentation. Enhances phosphorylation of CD79A, possibly by recruiting kinases which phosphorylate CD79A or by recruiting proteins which bind to CD79A and protect it from dephosphorylation.

Gene References into Functions

ablation of B cell antigen receptor ubiquitination in vivo uncouples the receptor from CD19 phosphorylation and phosphatidylinositol 3-kinase (PI3K) signals. PMID:29141870
B-cell inhibition by cross-linking CD79b is superior to B-cell depletion with anti-CD20 antibodies in treating murine collagen-induced arthritis. PMID:25471597
The cytoplasmic tail of IgG1 is strictly required for the surface expression of IgG1 when the expression of Iga/Igb heterodimer is down-regulated in B lymphoma. PMID:24548411
describe a novel mouse with a spontaneous mutation in the Cd79b gene leading to a block in B-cell development and agammaglobulinemia. PMID:19727123
The VHDJH recombination process at the IgH locus and the survival of pro-B cells that carry these rearrangements do not depend on the expression of Ig-beta molecules. PMID:12097390
Deletion in developing B cells leads to cell death; Igbeta expression is essential to maintain preB cell and immature B cell survival and to mediate B cell differentiation PMID:12165571
Spontaneous mutation in the Cd79b gene leads to a block in B-lymphocyte development at the C' (early pre-B) stage PMID:19727123

Hide All

Subcellular Location

Cell membrane; Single-pass type I membrane protein. Note=Following antigen binding, the BCR has been shown to translocate from detergent-soluble regions of the cell membrane to lipid rafts although signal transduction through the complex can also occur outside lipid rafts.

Tissue Specificity

B-cells.

Database Links

UNIGENE: Mm.2987

KEGG: mmu:15985

STRING: 10090.ENSMUSP00000129029

Promotions