LRVEGGPPSLTVNLGEEARLTCENNGRNPNITWWFSLQSNITWPPVPLGPGQGTTGQLFFPEVNKNHRGLYWCQVIENNILKRSCGTYLRVRNPVPRPFLDMGEGTKNRIITAEGIILLFCAVVPGTLLLFRKRWQNEKFGVDMPDDYEDENLYEGLNLDDCSMYEDISRGLQGTYQDVGNLHIGDAQLEKP
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Required in cooperation with CD79B for initiation of the signal transduction cascade activated by binding of antigen to the B-cell antigen receptor complex (BCR) which leads to internalization of the complex, trafficking to late endosomes and antigen presentation. Also required for BCR surface expression and for efficient differentiation of pro- and pre-B-cells. Stimulates SYK autophosphorylation and activation. Binds to BLNK, bringing BLNK into proximity with SYK and allowing SYK to phosphorylate BLNK. Also interacts with and increases activity of some Src-family tyrosine kinases. Represses BCR signaling during development of immature B-cells.
Gene References into Functions
BCR activation is accompanied by asymmetric conformational changes, possibly promoting the binding of Igalpha and Igbeta to differently localized signaling complexesPMID:24244439
CD79a myeloid cells showed enhanced ability to promote primary tumor growth and metastasis.PMID:24146823
Data indicate that in the absence of DGKzeta, the threshold for B cell antigen receptor (BCR) signaling, measured as activation of the Ras-extracellular signal-regulated kinase (ERK) pathway, was markedly reduced in mature follicular B cells.PMID:24129701
Data show that the B cell antigen receptor (BCR) and Igalpha may be required for B cell survival because they function as adaptor proteins in a BAFFR signaling pathway leading to activation of Syk, indicating crosstalk between the two receptors.PMID:23453634
The mouse B cell-specific mb-1 gene encodes an immunoreceptor tyrosine-based activation motif (ITAM) protein that may be evolutionarily conserved in diverse species by purifying selection.PMID:21688146
endocytosed BCR sequentially regulates MAPK and Akt signaling pathways from intracellular compartmentsPMID:21964606
Data indicate that both the Igalpha and the Igbeta cytoplasmic domains alone are sufficient for trafficking to lysosomal compartments, and are unaffected by mutation of 4 amino acid residues within their respective ITAMs.PMID:20837062
Arginine 198 in the tail of the Igalpha subunit of the BCR is methylated by the protein arginine methyltransferase 1. Methylation negatively regulates the calcium and PI-3 kinase pathways of the BCR, promoting signals leading to B cell differentiation.PMID:20231378
The direct recruitment of BLNK to immunoglobulin alpha couples the B-cell antigen receptor to distal signaling pathwaysPMID:11909947
IgA deficiency in lymphotoxin-deficient (LT(-/-)) mice could be fully reversed by reconstitution with LT-expressing bone marrow, despite the absence of both LNs and PPs.PMID:12006975
The VHDJH recombination process at the IgH locus and the survival of pro-B cells that carry these rearrangements do not depend on the expression of Ig-alpha molecules.PMID:12097390
Selective adherence of IgA to murine Peyer's patch M cells: evidence for a novel IgA receptor.PMID:12165508
Data show that expression of endogenous mb-1 transcripts correlates most closely with early-B-cell factor (EBF) expression and negatively with Id1, an inhibitor of E2A protein function, linking regulation of the mb-1 gene with EBF and E2A.PMID:12446773
Retrovirally expressed human Pax-5 protein activates endogenous early B-cell-specific mb-1 genes in mouse plasmacytoma cells, but only when the promoter is hypomethylated.PMID:12612069
Ig-alpha immunoreceptor tyrosine-based activation motif (ITAM) tyrosines (Y182 and Y193) are necessary for efficient pre-B cell differentiation.PMID:17163454
MHC II structural requirements for mediation of cell death signaling in a murine B cell lymphoma with Igalpha/betaPMID:18194817
Show
More
Hide
All
Subcellular Location
Cell membrane; Single-pass type I membrane protein. Note=Following antigen binding, the BCR has been shown to translocate from detergent-soluble regions of the cell membrane to lipid rafts although signal transduction through the complex can also occur outside lipid rafts.