Recombinant Mouse Apelin receptor (Aplnr)

CSB-CF001910MO
Size:
20μg
20μg100μg
US$5315
Quantity:
Express system: in vitro E.coli expression system
Species: Mus musculus (Mouse)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Orders can only be placed from within the U.S.

Product Details

Target Names
Aplnr
Uniprot NO.
Species
Mus musculus (Mouse)
Source
in vitro E.coli expression system
Expression Region
1-377
Target Protein Sequence
MEDDGYNYYGADNQSECDYADWKPSGALIPAIYMLVFLLGTTGNGLVLWTVFRTSREKRR SADIFIASLAVADLTFVVTLPLWATYTYREFDWPFGTFSCKLSSYLIFVNMYASVFCLTG LSFDRYLAIVRPVANARLRLRVSGAVATAVLWVLAALLAVPVMVFRSTDASENGTKIQCY MDYSMVATSNSEWAWEVGLGVSSTAVGFVVPFTIMLTCYFFIAQTIAGHFRKERIEGLRK RRRLLSIIVVLVVTFALCWMPYHLVKTLYMLGSLLHWPCDFDIFLMNVFPYCTCISYVNS CLNPFLYAFFDPRFRQACTSMLCCDQSGCKGTPHSSSAEKSASYSSGHSQGPGPNMGKGG EQMHEKSIPYSQETLVD
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Description

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function
Receptor for apelin receptor early endogenous ligand (APELA) and apelin (APLN) hormones coupled to G proteins that inhibit adenylate cyclase activity. Plays a key role in early development such as gastrulation, blood vessels formation and heart morphogenesis by acting as a receptor for APELA hormone. May promote angioblast migration toward the embryonic midline, i.e. the position of the future vessel formation, during vasculogenesis. Promotes sinus venosus (SV)-derived endothelial cells migration into the developing heart to promote coronary blood vessel development. Plays also a role in various processes in adults such as regulation of blood vessel formation, blood pressure, heart contractility and heart failure.
Gene References into Functions
  1. the expression of APLNR (APJ/AGTRL1), the only known receptor for apelin, is predominantly restricted to the endothelial cells. PMID:28904225
  2. The ELA-APJ axis protects from pressure overload-induced heart failure possibly via suppression of ACE expression and pathogenic angiotensin II signaling. PMID:28371822
  3. Internalization does not appear to contribute to the desensitization of APJ-mediated ppERK1/2 activation. PMID:27492965
  4. the ELABELA (ELA)-APJ signaling axis is only required for sinus venosus-derived progenitors. PMID:28890073
  5. These results demonstrate a new pharmacologic property of protamine-blockade of APJ-that could explain some adverse effects observed in protamine-treated patients, and that the established antiangiogenic activity of protamine would rely on APJ antagonism. PMID:28242772
  6. Apelin-36-[L28C(30kDa-PEG)] provides a starting point for the development of diabetes therapeutics that are devoid of the blood pressure effects associated with canonical APJ activation PMID:27994053
  7. Results show that obese mice had significantly lower mRNA and protein expressions of apelin/ APJ in skeletal muscles than the normal body weight mice. PMID:27834140
  8. These results demonstrate that overexpression of APJ in cardiomyocytes has adverse effects on cardiac function in male and non-pregnant mice and that lactation contributes to the development of postpartum cardiomyopathy in the heart with APJ overexpression. PMID:27033703
  9. Endothelial CXCR4 is negatively regulated by miR-139-5p, whose transcription is in turn induced by laminar flow and APLN/APLNR signalling. PMID:27068353
  10. apelin is produced by arterial endothelial cells (ECs) during embryogenesis, induces chemotaxis of venous ECs, and promotes the production of secreted Frizzled-related protein 1 by apelin receptor(+) ECs PMID:25920569
  11. Findings demonstrate a stimulatory role for the islet cell apelin-APJ signaling axis in regulation of pancreatic islet homeostasis and in metabolic induced beta-cell hyperplasia. PMID:25965959
  12. ERG and APLNR are essential for endothelial homeostasis in venules in the lung and that perturbation in ERG-APLNR signaling is crucial for the development of pulmonary veno-occlusive disease. PMID:25062690
  13. These findings suggest that apelin-APJ signaling is a potential therapeutic target in the treatment of vasculogenic erectile dysfunction. PMID:23578329
  14. regulates the Nodal/Bone Morphogenetic Protein antagonist Cerberus and the Baf60c/Smarcd3 subunit of the Brg1/Brm-associated factors (BAF) chromatin-remodelling complex PMID:23787002
  15. In obese and insulin-resistant mice, plasma apelin concentration after fasting was not modified but, the gene-expression level of the APL/APJ system was augmented in the white adipose tissue and reduced in the brown adipose tissue, liver and in kidneys. PMID:23747606
  16. These findings imply that the pancreatic apelin-APJ system functions to curb the inflammatory and fibrosis responses during pancreatitis, and that apelin reduces inflammation and fibrosis by reducing neutrophil recruitment and PSC activity. PMID:23681476
  17. More than half of the expected Apj-/- embryos died in utero because of cardiovascular developmental defects. Apelin-APJ signaling plays a novel role as a potent regulator of endothelial MEF2 function in the developing cardiovascular system. PMID:23603510
  18. Apelin-APJ signalling may promote Fas-induced liver injury at least partially via JNK activation. PMID:23121371
  19. Centrally administered apelin-13 elicited depression-like behavior in mice, which was mediated via APJ receptor and kappa-opioid receptor, but not CRF receptor. PMID:22728209
  20. We conclude that apelin functions as a new and potent chemoattractant for circulating cKit+/Flk1+/Aplnr+ cells during early myocardial repair, providing myocardial protection against ischemic damage by improving neovascularization via paracine action. PMID:22753078
  21. study found activation of ATreceptors stimulates apelin secretion in Ca(2), protein kinase C and MAPK kinase dependent ways; activation of AT receptors inhibits apelin secretion through cAMP and cGMP dependent pathways; expression of apelin receptor is si PMID:22249006
  22. data indicate that APJ is a bifunctional receptor for both mechanical stretch and the endogenous peptide apelin; by sensing the balance between these stimuli, APJ occupies a pivotal point linking sustained overload to cardiomyocyte hypertrophy PMID:22810587
  23. the novel peptide apelin and its receptor APJ can induce the morphological and functional maturation of blood vessels in tumors PMID:22037214
  24. Apelin receptor mRNA and apelin-13 binding site distribution in mouse tissues PMID:22197493
  25. endothelial cells promote the maturation of astrocytes through the apelin/APJ system in mice PMID:22357924
  26. Disruption of apelin-APJ signaling can exacerbate pulmonary hypertension mediated by decreased activation of AMP-activated kinase and eNOS. PMID:21233449
  27. Apelin receptor expression by smooth muscle cells provides a paracrine pathway in injured vessels that allows endothelial-derived apelin to stimulate their division and migration into the neointima. PMID:20176814
  28. Role for the apelinergic system in mechanisms controlling fluid homeostasis, particularly at a neuroendocrine level. PMID:20136689
  29. data support a role for the apelin-APJ system in the regulation of smooth muscle, epithelial and goblet cell function in the GI tract PMID:19660504
  30. Expression of the murine msr/apj receptor and its ligand apelin is upregulated during formation of the retinal vessels. PMID:11744380
  31. APJ exerts the hypotensive effect in vivo and plays a counterregulatory role against the pressor action of angiotensin II PMID:15087458
  32. Data show that the apj receptor is expressed in pancreatic islets and that apelin-36 inhibits glucose-stimulated insulin secretion both in vivo and in vitro. PMID:15970338
  33. APJ/apelin-meidated molecular mechanisms for cell migration were reported. PMID:16211245
  34. APJ is unlikely to be a gene causing idiopathic dilated cardiomyopathy, but the independent correlation between the 212A allele and a better prognosis suggests that it might act as a modifier gene. PMID:17826642
  35. The apelin-APJ system is a mediator of oxidative stress in vascular tissue, and thus we propose it to be a critical factor in atherogenesis under high-cholesterol dietary conditions. PMID:17884970
  36. Involved in the regulation of blood vessel diameter during angiogenesis. PMID:18200044
  37. apelin/APJ signaling pathways play a critical role in the development of the functional vascular network in adipose tissue. PMID:18708591
  38. physiological role for APJ in mechanisms of water intake and fluid retention suggests an anti-diuretic effect of apelin in vivo PMID:19578099
  39. Results demonstrate that endogenous apelin-APJ signaling plays a modest role in maintaining basal cardiac function in adult mice with a more substantive role during conditions of stress. PMID:19767528

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Expressed in coronary endothelial cells (at protein level). Expressed in the embryo, allantoic and endothelial precursor cells of the yolk sac at 8 days post-coitum (dpc). Expressed in the secondary heart field and somite at 8.25 dpc. Expressed in fetal a
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products