MEDDGYNYYGADNQSECDYADWKPSGALIPAIYMLVFLLGTTGNGLVLWTVFRTSREKRR SADIFIASLAVADLTFVVTLPLWATYTYREFDWPFGTFSCKLSSYLIFVNMYASVFCLTG LSFDRYLAIVRPVANARLRLRVSGAVATAVLWVLAALLAVPVMVFRSTDASENGTKIQCY MDYSMVATSNSEWAWEVGLGVSSTAVGFVVPFTIMLTCYFFIAQTIAGHFRKERIEGLRK RRRLLSIIVVLVVTFALCWMPYHLVKTLYMLGSLLHWPCDFDIFLMNVFPYCTCISYVNS CLNPFLYAFFDPRFRQACTSMLCCDQSGCKGTPHSSSAEKSASYSSGHSQGPGPNMGKGG EQMHEKSIPYSQETLVD
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Receptor for apelin receptor early endogenous ligand (APELA) and apelin (APLN) hormones coupled to G proteins that inhibit adenylate cyclase activity. Plays a key role in early development such as gastrulation, blood vessels formation and heart morphogenesis by acting as a receptor for APELA hormone. May promote angioblast migration toward the embryonic midline, i.e. the position of the future vessel formation, during vasculogenesis. Promotes sinus venosus (SV)-derived endothelial cells migration into the developing heart to promote coronary blood vessel development. Plays also a role in various processes in adults such as regulation of blood vessel formation, blood pressure, heart contractility and heart failure.
Gene References into Functions
the expression of APLNR (APJ/AGTRL1), the only known receptor for apelin, is predominantly restricted to the endothelial cells.PMID:28904225
The ELA-APJ axis protects from pressure overload-induced heart failure possibly via suppression of ACE expression and pathogenic angiotensin II signaling.PMID:28371822
Internalization does not appear to contribute to the desensitization of APJ-mediated ppERK1/2 activation.PMID:27492965
the ELABELA (ELA)-APJ signaling axis is only required for sinus venosus-derived progenitors.PMID:28890073
These results demonstrate a new pharmacologic property of protamine-blockade of APJ-that could explain some adverse effects observed in protamine-treated patients, and that the established antiangiogenic activity of protamine would rely on APJ antagonism.PMID:28242772
Apelin-36-[L28C(30kDa-PEG)] provides a starting point for the development of diabetes therapeutics that are devoid of the blood pressure effects associated with canonical APJ activationPMID:27994053
Results show that obese mice had significantly lower mRNA and protein expressions of apelin/ APJ in skeletal muscles than the normal body weight mice.PMID:27834140
These results demonstrate that overexpression of APJ in cardiomyocytes has adverse effects on cardiac function in male and non-pregnant mice and that lactation contributes to the development of postpartum cardiomyopathy in the heart with APJ overexpression.PMID:27033703
Endothelial CXCR4 is negatively regulated by miR-139-5p, whose transcription is in turn induced by laminar flow and APLN/APLNR signalling.PMID:27068353
apelin is produced by arterial endothelial cells (ECs) during embryogenesis, induces chemotaxis of venous ECs, and promotes the production of secreted Frizzled-related protein 1 by apelin receptor(+) ECsPMID:25920569
Findings demonstrate a stimulatory role for the islet cell apelin-APJ signaling axis in regulation of pancreatic islet homeostasis and in metabolic induced beta-cell hyperplasia.PMID:25965959
ERG and APLNR are essential for endothelial homeostasis in venules in the lung and that perturbation in ERG-APLNR signaling is crucial for the development of pulmonary veno-occlusive disease.PMID:25062690
These findings suggest that apelin-APJ signaling is a potential therapeutic target in the treatment of vasculogenic erectile dysfunction.PMID:23578329
regulates the Nodal/Bone Morphogenetic Protein antagonist Cerberus and the Baf60c/Smarcd3 subunit of the Brg1/Brm-associated factors (BAF) chromatin-remodelling complexPMID:23787002
In obese and insulin-resistant mice, plasma apelin concentration after fasting was not modified but, the gene-expression level of the APL/APJ system was augmented in the white adipose tissue and reduced in the brown adipose tissue, liver and in kidneys.PMID:23747606
These findings imply that the pancreatic apelin-APJ system functions to curb the inflammatory and fibrosis responses during pancreatitis, and that apelin reduces inflammation and fibrosis by reducing neutrophil recruitment and PSC activity.PMID:23681476
More than half of the expected Apj-/- embryos died in utero because of cardiovascular developmental defects. Apelin-APJ signaling plays a novel role as a potent regulator of endothelial MEF2 function in the developing cardiovascular system.PMID:23603510
Apelin-APJ signalling may promote Fas-induced liver injury at least partially via JNK activation.PMID:23121371
Centrally administered apelin-13 elicited depression-like behavior in mice, which was mediated via APJ receptor and kappa-opioid receptor, but not CRF receptor.PMID:22728209
We conclude that apelin functions as a new and potent chemoattractant for circulating cKit+/Flk1+/Aplnr+ cells during early myocardial repair, providing myocardial protection against ischemic damage by improving neovascularization via paracine action.PMID:22753078
study found activation of ATreceptors stimulates apelin secretion in Ca(2), protein kinase C and MAPK kinase dependent ways; activation of AT receptors inhibits apelin secretion through cAMP and cGMP dependent pathways; expression of apelin receptor is siPMID:22249006
data indicate that APJ is a bifunctional receptor for both mechanical stretch and the endogenous peptide apelin; by sensing the balance between these stimuli, APJ occupies a pivotal point linking sustained overload to cardiomyocyte hypertrophyPMID:22810587
the novel peptide apelin and its receptor APJ can induce the morphological and functional maturation of blood vessels in tumorsPMID:22037214
Apelin receptor mRNA and apelin-13 binding site distribution in mouse tissuesPMID:22197493
endothelial cells promote the maturation of astrocytes through the apelin/APJ system in micePMID:22357924
Disruption of apelin-APJ signaling can exacerbate pulmonary hypertension mediated by decreased activation of AMP-activated kinase and eNOS.PMID:21233449
Apelin receptor expression by smooth muscle cells provides a paracrine pathway in injured vessels that allows endothelial-derived apelin to stimulate their division and migration into the neointima.PMID:20176814
Role for the apelinergic system in mechanisms controlling fluid homeostasis, particularly at a neuroendocrine level.PMID:20136689
data support a role for the apelin-APJ system in the regulation of smooth muscle, epithelial and goblet cell function in the GI tractPMID:19660504
Expression of the murine msr/apj receptor and its ligand apelin is upregulated during formation of the retinal vessels.PMID:11744380
APJ exerts the hypotensive effect in vivo and plays a counterregulatory role against the pressor action of angiotensin IIPMID:15087458
Data show that the apj receptor is expressed in pancreatic islets and that apelin-36 inhibits glucose-stimulated insulin secretion both in vivo and in vitro.PMID:15970338
APJ/apelin-meidated molecular mechanisms for cell migration were reported.PMID:16211245
APJ is unlikely to be a gene causing idiopathic dilated cardiomyopathy, but the independent correlation between the 212A allele and a better prognosis suggests that it might act as a modifier gene.PMID:17826642
The apelin-APJ system is a mediator of oxidative stress in vascular tissue, and thus we propose it to be a critical factor in atherogenesis under high-cholesterol dietary conditions.PMID:17884970
Involved in the regulation of blood vessel diameter during angiogenesis.PMID:18200044
apelin/APJ signaling pathways play a critical role in the development of the functional vascular network in adipose tissue.PMID:18708591
physiological role for APJ in mechanisms of water intake and fluid retention suggests an anti-diuretic effect of apelin in vivoPMID:19578099
Results demonstrate that endogenous apelin-APJ signaling plays a modest role in maintaining basal cardiac function in adult mice with a more substantive role during conditions of stress.PMID:19767528
Show
More
Hide
All
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Expressed in coronary endothelial cells (at protein level). Expressed in the embryo, allantoic and endothelial precursor cells of the yolk sac at 8 days post-coitum (dpc). Expressed in the secondary heart field and somite at 8.25 dpc. Expressed in fetal a