VIKPKKNKTEGEKSTEKPKRKKKGGKNGKGRRNKKKKNPCTAKFQNFCIHGECRYIENLE VVTCNCHQDYFGERCGEKSMKTHSEDDKDLSKIAVVAVTIFVSAIILAAIGIGIVITVHL WKRYFREYEGETEERRRLRQENGTVHAIA
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Ligand of the EGF receptor/EGFR. Autocrine growth factor as well as a mitogen for a broad range of target cells including astrocytes, Schwann cells and fibroblasts.
Gene References into Functions
Amphiregulin plays an important role in promoting cardiac fibrosis after myocardial infarction partly though activating the EGFR pathway.PMID:29349588
The studies indicate that HIF2-alpha induces myocardial AREG expression in cardiac myocytes, which increases myocardial ischemia tolerance.PMID:29483579
Areg transgenic mice showed less adipose tissue mass with increased mRNA expression levels of Tnf-alpha and peroxisome proliferator-activated receptor gamma coactivator 1 alpha and delayed white adipose tissue development during the convalescent stage in a dextran sodium sulfate-induced colitis model.PMID:29341420
Regulatory T-cell-intrinsic amphiregulin is dispensable for suppressive function.PMID:27040371
activated alveolar macrophages also exerted a protective effect on the lung tissues by producing high-level amphiregulin in lipopolysaccharide-induced acute lung injuryPMID:26808632
AREG overexpression in osteoblasts induces a transient high bone mass phenotype in the trabecular compartment of the appendicular skeleton by a growth-related, non-cell autonomous mechanismPMID:26103093
AREG-silenced keratinocytes plays an important role in regulation cell proliferation.PMID:26802239
Hepatic CD206-positive macrophages express amphiregulin to promote the immunosuppressive activity of regulatory T cells in HBV infection.PMID:26216935
Areg may have a role in classically activated macrophagesPMID:26365345
After activation with IL-33, expression of AREG is a dominant functional signature of gut-associated IL-33-dependent group 2 innate lymphoid cells. The frequency and number of AREG-expressing ILC2s increases following intestinal injury.PMID:26243875
AR induces hHSC fibrogenic activity via multiple mitogenic signaling pathways, and is upregulated in murine and human NASH, suggesting that AR antagonists may be clinically useful anti-fibrotics in NAFLD.PMID:25744849
hormones and/or factors in addition to E that upregulate AREG can promote mammary gland development and have the potential to affect breast cancer risk associated with pubertal mammary gland developmentPMID:23705924
Our data show that AREG is essential for ultraviolet therapy-induced contact hypersensitivity suppression.PMID:25089660
Pre-maturation with cAMP modulators in conjunction with EGF-like peptides during in vitro maturation enhances mouse oocyte developmental competence.PMID:24488930
During high-pressure ventilation, Nrf2 becomes activated and induces AREG, leading to a positive feedback loop between Nrf2 and AREG, which involves the p38 MAPK and results in the expression of cytoprotective genes.PMID:24921206
AREG plays pro-neoplastic roles in colorectal carcinogenesisPMID:23263765
Amphiregulin expression is regulated by the androgen/androgen receptor pathway.PMID:23415714
Amphiregulin enhances regulatory T cell-suppressive function via the epidermal growth factor receptor.PMID:23333074
Polycystin-1 regulates amphiregulin expression through CREB and AP1 signalling, which has implications in ADPKD cell proliferationPMID:22570239
AR, or AR-activated EGFR signaling, is a potential therapeutic target for idiopathic pulmonary fibrosis associated with TGF-beta1 activation.PMID:23086930
The data showed that STAT6 regulated Alternaria-induced lung natrual-helper-cell proliferation and expression of amphiregulin.PMID:22865552
data demonstrate that AREG-dependent EGFR signaling in airway epithelial cells contributes to MCM in naphthalene-induced lung injury. We conclude that AREG may represent a determinant of nonallergic chronic lung diseases complicated by MCMPMID:22493011
Lung tumor-associated dendritic cell-derived amphiregulin increased cancer progression.PMID:21742971
This study implicates that EREG mediates signals downstream of Areg mRNA expression and that EGFR-ERBB2 signals contributes to regulation of ovulation process.PMID:21237132
A TLR-->MyD88-->AREG/EREG-->EGFR signaling pathway is represented in nonhematopoietic cells of the intestinal tract, responds to microbial stimuli once barriers are breached, and mediates protection against dextran sulfate sodium-induced colitis.PMID:21041656
ATP released from tumor cells might exert a tumorigenic action by stimulating the secretion of AREG from dendritic cells.PMID:20651071
is not essential for induction of acute airway inflammationPMID:20414053
AREG plays a critical role in testinal epithelial growth.PMID:20534719
Treatment of granulosa cells with forskolin to mimic the effects of LH increases AREG promoter activity in a RIP140-dependent manner.PMID:20308529
Results describe the role of amphiregulin in an experimental model of bleomycin-induced pneumopathy in mice.PMID:19915156
Data show that Dmp1 directly bound to the genomic loci of Areg, Tsp-1, JunB and Egr1.PMID:19816943
These data demonstrate AREG mediates the function of a subset of mammary progenitor cells in vitro.PMID:19913532
identified amphiregulin as a key regulator of hepatic acute-phase protein gene expression during inflammation and liver regenerationPMID:19815304
Amphiregulin is a mitogen for adult neural stem cells.PMID:12205669
amphiregulin binds to EGF receptor and has a role in stimulation of lung epithelial cells upon exposure to tobacco smokePMID:12711607
epidermal growth factor (EGF) family members amphiregulin, epiregulin, and beta-cellulin are paracrine mediators that propagate the LH signal throughout the ovulatory folliclePMID:14726596
Castration leads to adaptive increase in the concentrations of a subset of growth factors from the EGF network in the androgen sensitive CWR22 prostate cancer xenograft.PMID:15651060
amphiregulin is a protective factor induced in response to liver damagePMID:15753092
ADAM17 plays a crucial role in mammary morphogenesis by releasing amphiregulin from mammary epithelial cellsPMID:16079154
findings show that T helper 2 (TH2) cells express amphiregulin; expression of amphiregulin by TH2 cells provides a newly recognized link between type 2 adaptive immune response & proliferation of gut epithelial cells that aids helminth parasite removalPMID:17170297
amphiregulin is an important paracrine mediator of estrogen function specifically required for puberty-induced ductal elongation, but not for any earlier or later developmental stagesPMID:17369357
The absence of amphiregulin promoted the rapid emergence of spasmolytic polypeptide-expressing metaplasia in response to oxyntic atrophy.PMID:17484876
Amphiregulin plays a specific role in liver fibrosis. Amphiregulin may contribute to the expression of fibrogenic mediators, as well as to the growth and survival of fibrogenic cells.PMID:18634036
findings identify Amphiregulin as a factor for resistance of glioma cells to delta9-Tetrahydrocannabinol induced apoptosisPMID:19229996
AR-/- mice develop spasmolytic polypeptide expression metaplasia, which gives rise to goblet cell intestinal metaplasia and invasive fundic dysplastic lesions.PMID:19230855
Data observed that the expression of amphiregulin, betacellulin and epiregulin was significantly increased in young erythropoietic protoporphyria mice when compared to aged-matched controls in all genetic backgrounds.PMID:19267999
EGFR ligands (including AREG) are protective in acute lung injury and increase more in mice deficient in Mt1/2PMID:16166738