MQLETQDALYVALELVIAALAVAGNVLVCAAVGASSALQTPTNYFLVSLATADVAVGLFA IPFAITISLGFCTDFHGCLFLACFVLVLTQSSIFSLLAVAVDRYLAIRVPLRYKGLVTGT RARGIIAVLWVLAFGIGLTPFLGWNSKDSATSNCTELGDGIANKSCCPVTCLFENVVPMS YMVYFNFFGCVLPPLLIMLVIYIKIFMVACKQLQRMELMDHSRTTLQREIHAAKSLAMIV GIFALCWLPVHAINCITLFHPALAKDKPKWVMNVAILLSHANSVVNPIVYAYRNRDFRYS FHKIISRYVLCQAETKGGSGQAGAQSTLSLGL
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Receptor for adenosine. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.
Gene References into Functions
Obesity is related with a condition of colonic inflammation, leading to an increase of A2BR expression. A2BR, modulating the activity of excitatory tachykininergic nerves, participate to the enteric dysmotility associated with obesity.PMID:28808842
these results suggest that A2BAR stimulation inhibits the activation of ERK1/2, p38 and NF-kappaB by RANKL, which suppresses the induction of osteoclast marker genes, thus contributing to the decrease in osteoclast cell-cell fusion and bone resorption activity.PMID:29047264
the pivotal role of CXCR4- and CXCR7-inhibition in acute pulmonary inflammation, which depended on A2B-receptor signaling, is reported.PMID:28542132
Adora2B stimulation promotes FGF2 and CXCL12 expression in FAP-positive melanoma-associated fibroblasts, contributing to the creation of a tumor-promoting microenvironment.PMID:27590504
activation of adenosine A2B receptors on myeloid cells caused nociceptor hyperexcitability and promoted chronic pain via soluble IL-6 receptor trans-signaling.PMID:27320922
findings suggest that hypoxia, through HIF1A, contributes to the development and progression of pulmonary fibrosis through its regulation of ADORA2B expression on alternatively activated macrophages, cell differentiation, and production of profibrotic mediatorsPMID:28701304
It has been reported that signaling through hepatocellular Adora2b adenosine receptors dampens IR injury of the liver.PMID:27404219
Diabetes resulted in an increased A2A/A2B receptor expression in coronary arteries which resulted in enhanced A2A/A2B-mediated increase in coronary flow observed in diabetic hearts.PMID:26654777
A2B adenosine receptor-induced VEGF production and angiogenesis are involved in myeloid-derived suppressor cells in a mouse melanoma modelPMID:26317647
Angiotensin II stimulation alters vasomotor response to adenosine in mouse mesenteric artery: role for A1 and A2B adenosine receptorsPMID:26227882
our results suggest that intestinal epithelial Adora2b signaling provides protection during intestinal inflammation via enhancing mucosal barrier responses.PMID:25850656
exposure of DCs to A2BR agonist facilitated gammadelta T cell activation, leading to augmented Th17 responses and progressive EAU development.PMID:26147733
IFN-gamma priming of macrophages selectively prevents the induction of the A2bR in macrophages to mitigate sensitivity to adenosine and to prevent this regulatory transition.PMID:26355158
These findings implicate that tissue-specific targeting of Adora2b seems to be desirable when using Adora2b agonists to prevent or treat myocardial ischemia.PMID:26136425
alveolar epithelial A2B adenosine receptor signaling contributes to lung protection, and they implicate inhaled A2B adenosine receptor agonists in ALI treatment.PMID:26188061
the adenosine A2b receptor was shown to be the only one of the adenosine receptors whose cardiac expression is induced by ischemia in both mice and humans and whose function is implicated in ischemic pre- or post-conditioningPMID:24502579
activation of the ADORA2B on macrophages plays an active role in the pathogenesis of lung fibrosis and pulmonary hypertensionPMID:25318478
the A2B adenosine receptor (ADORA2B) is essential for adenosine-induced SphK1 activity in human and mouse normal and sickle erythrocytes in vitroPMID:25587035
Findings support a potentially destructive role for A2BAR under intestinal ischemia/reperfusion and acute hypoxic conditions.PMID:24966910
study implicates the A2bAR as a regulator of adipocyte differentiation and the A2bAR-KLF4 axis as a potentially significant modulator of adipose biology.PMID:24928509
Thus, adenosine acts as a danger-associated molecular pattern (DAMP) that initiates helminth-induced type 2 immune responses through A2B adenosine receptor.PMID:24629340
findings reveal that excess adenosine-mediated ADORA2B signaling underlies reduced penile PDE activity by decreasing PDE5 gene expression in a HIF-1alpha-dependent mannerPMID:24614760
CD73-dependent production of extracellular adenosine and endothelial Adora2b signaling protects kidney during diabetic nephropathy.PMID:24262796
found that stimulation of A2B adenosine receptors suppressed free fatty acid-induced deleterious inflammatory and metabolic activation of macrophagesPMID:24194503
Studies of ventilator-induced lung injury revealed induction of the ADORA2B during ALI in vivo that was abolished following HIF inhibition or genetic deletion of Hif1a.PMID:24391213
the A2B receptor signaling linked to up-regulation of pro-angiogenic factors in cardiac Sca-1(+)CD31(-) stromal cells is essential for overall improvement of cardiac recovery seen after their transplantation to the injured heart.PMID:23827818
an important role of the A2B receptor-dependent upregulation of JunB in VEGF production and possibly other AP-1-regulated events.PMID:24136993
blockade of ADORA2B attenuates the development of a pulmonary hypertension phenotype that correlates with reduced levels of hyaluronan (HA) deposition in vessels and down-regulation of genes involved in synthesis of HAPMID:23855769
Data suggest that crosstalk pathway between ENT2 and alveolar epithelial Adora2b in lung protection during acute lung injury (ALI) opens possibilities for combined therapies targeted to this protein set.PMID:23603835
Data indicate that CD73 promoted metastasis through the activation of both A2A and A2B receptors.PMID:23964122
Adenosine regulates bone metabolism via A1, A2A, and A2B receptors.PMID:23682121
CD73 promotes the production of renal adenosine that is a prominent driver of renal hypertension by enhanced ADORA2B signaling-mediated endothelin-1 induction in a hypoxia-inducible factor-alpha-dependent manner.PMID:23584256
Activation of Adenosine A2B receptors in cortical neurons induces leukemia inhibitory factor release.PMID:22894638
Binding of A(2B)AR to specific sites on p105 prevents polyubiquitylation and degradation of p105 protein.PMID:22767505
study identified the A2bAR as a significant regulator of HFD-induced hallmarks of T2D, thereby pointing to its therapeutic potential.PMID:22848385
A2B adenosine receptor is upregulated in the peripheral lymphoid tissues of experimental autoimmune encephalomyelitis (EAE) mice.PMID:23225885
T helper (Th)2-type cells demonstrate predominance for A2B receptor expression by myeloid cells as a mechanism of development of asthma-like pulmonary inflammation.PMID:22956582
Distinct roles for hematopoietic cell A(2b) receptor in cell trafficking and for endothelial A(2b) receptor for microvascular permeability.PMID:22707616
Study identified the A2BAR as a new regulator of osteoblast differentiation, bone formation, and fracture repair.PMID:22403399
studies identify adenosine-elicited stabilization of Per2 in the control of HIF-dependent cardiac metabolism and ischemia tolerance and implicate Per2 stabilizationPMID:22504483
It is proposed that A2B adenosine receptor activation may be used by L. amazonensis to inhibit dendritic cell function and evade the immune response.PMID:22311598
This studiy identified a novel regulator of sweet taste, the A2BR, which functions to potentiate sweet responses in posterior lingual taste fields.PMID:22253866
the A(2b)AR regulates liver SREBP-1, hyperlipidemia, and atherosclerosisPMID:22144568
The stimulatory effect of adenosine required primarily A(2B) receptors in activated macrophages.PMID:21926236
Adora2b receptors are significantly associated with expression of the sweet taste receptor subunit Tas1r2.PMID:22219293
blockade of A(2B)ARs enhances DC activation and CXCR3-dependent antitumor responses.PMID:22116822
adenosine augmented IL-10 production by stimulating p38 MAPK. Collectively, our results establish that A(2B)ARs augment IL-10 production by activated murine microglia.PMID:22116830
Both adenosine A(2A) and A(2B) receptors are required for adenosine A(1) receptor-mediated cardioprotection, implicating a role for interactions among receptor subtypes.PMID:21743001
lowering adenosine in wild-type mice or genetic deletion of A(2B)R in mutant mice significantly attenuated PI3K/AKT activation, eNOS phosphorylation, and subsequent impaired penile erectionPMID:21566208
suggested a mechanism for putative proinflammatory effects of A(2B)ARPMID:21593380