Home
Product
Protein
Transmembrane Proteins
Recombinant Mouse ATP-binding cassette sub-family G member 8 (Abcg8)

Recombinant Mouse ATP-binding cassette sub-family G member 8 (Abcg8)

Code: CSB-CF880562MO

Rate （N/A）
Review （0）

Size:

20μg100μg

US$7530

Quantity:

Express system: in vitro E.coli expression system

Species: Mus musculus (Mouse)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

Abcg8

Uniprot NO.

Q9DBM0

Alternative Names

Abcg8; ATP-binding cassette sub-family G member 8; Sterolin-2

Species

Mus musculus (Mouse)

Source

in vitro E.coli expression system

Expression Region

1-673

Target Protein Sequence

MAEKTKEETQLWNGTVLQDASQGLQDSLFSSESDNSLYFTYSGQSNTLEVRDLTYQVDIA SQVPWFEQLAQFKIPWRSHSSQDSCELGIRNLSFKVRSGQMLAIIGSSGCGRASLLDVIT GRGHGGKMKSGQIWINGQPSTPQLVRKCVAHVRQHDQLLPNLTVRETLAFIAQMRLPRTF SQAQRDKRVEDVIAELRLRQCANTRVGNTYVRGVSGGERRRVSIGVQLLWNPGILILDEP TSGLDSFTAHNLVTTLSRLAKGNRLVLISLHQPRSDIFRLFDLVLLMTSGTPIYLGAAQQ MVQYFTSIGHPCPRYSNPADFYVDLTSIDRRSKEREVATVEKAQSLAALFLEKVQGFDDF LWKAEAKELNTSTHTVSLTLTQDTDCGTAVELPGMIEQFSTLIRRQISNDFRDLPTLLIH GSEACLMSLIIGFLYYGHGAKQLSFMDTAALLFMIGALIPFNVILDVVSKCHSERSMLYY ELEDGLYTAGPYFFAKILGELPEHCAYVIIYAMPIYWLTNLRPVPELFLLHFLLVWLVVF CCRTMALAASAMLPTFHMSSFFCNALYNSFYLTAGFMINLDNLWIVPAWISKLSFLRWCF SGLMQIQFNGHLYTTQIGNFTFSILGDTMISAMDLNSHPLYAIYLIVIGISYGFLFLYYL SLKLIKQKSIQDW
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

ABCG5 and ABCG8 form an obligate heterodimer that mediates Mg(2+)- and ATP-dependent sterol transport across the cell membrane. Plays an essential role in the selective transport of the dietary cholesterol in and out of the enterocytes and in the selective sterol excretion by the liver into bile. Plays an important role in preventing the accumulation of dietary plant sterols in the body. Required for normal sterol homeostasis. The heterodimer with ABCG5 has ATPase activity.

Gene References into Functions

Alternatively spliced forms for Abcg8 were identified, resulting from a CAG repeat at the intron 1 splice-acceptor site, causing a deletion of a glutamine PMID:11907139
Although Abcg8 is essential for most diosgenin-induced biliary cholesterol hypersecretion, diosgenin probably does not interact directly with Abcg5/Abcg8, but rather increases cholesterol delivery to the heterodimer. PMID:15619238
aging significantly enhances cholesterol absorption by suppressing expression of the jejunal and ileal sterol efflux transporter Abcg8 PMID:16179600
distinct roles for liver and intestinal ABCG5/G8 in modulating sterol metabolism and atherosclerosis in abcg8 transgenic mice. PMID:17060690
Deletion of the Abcg8 gene alone significantly increases the mass of intestinal cholesterol and sitostanol absorption and reduces but does not eliminate hepatic secretion of cholesterol. PMID:17393508
ABCG8 mice develop sitosterolemia, a genetic disorder characterized by the accumulation of phytosterols in blood and tissues PMID:18796403