Abcg5; ATP-binding cassette sub-family G member 5; Sterolin-1
Species
Mus musculus (Mouse)
Source
in vitro E.coli expression system
Expression Region
1-652
Target Protein Sequence
MGELPFLSPEGARGPHINRGSLSSLEQGSVTGTEARHSLGVLHVSYSVSNRVGPWWNIKS CQQKWDRQILKDVSLYIESGQIMCILGSSGSGKTTLLDAISGRLRRTGTLEGEVFVNGCE LRRDQFQDCFSYVLQSDVFLSSLTVRETLRYTAMLALCRSSADFYNKKVEAVMTELSLSH VADQMIGSYNFGGISSGERRRVSIAAQLLQDPKVMMLDEPTTGLDCMTANQIVLLLAELA RRDRIVIVTIHQPRSELFQHFDKIAILTYGELVFCGTPEEMLGFFNNCGYPCPEHSNPFD FYMDLTSVDTQSREREIETYKRVQMLECAFKESDIYHKILENIERARYLKTLPTVPFKTK DPPGMFGKLGVLLRRVTRNLMRNKQAVIMRLVQNLIMGLFLIFYLLRVQNNTLKGAVQDR VGLLYQLVGATPYTGMLNAVNLFPMLRAVSDQESQDGLYHKWQMLLAYVLHVLPFSVIAT VIFSSVCYWTLGLYPEVARFGYFSAALLAPHLIGEFLTLVLLGIVQNPNIVNSIVALLSI SGLLIGSGFIRNIQEMPIPLKILGYFTFQKYCCEILVVNEFYGLNFTCGGSNTSMLNHPM CAITQGVQFIEKTCPGATSRFTANFLILYGFIPALVILGIVIFKVRDYLISR
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
ABCG5 and ABCG8 form an obligate heterodimer that mediates Mg(2+)- and ATP-dependent sterol transport across the cell membrane. Plays an essential role in the selective transport of dietary plant sterols and cholesterol in and out of the enterocytes and in the selective sterol excretion by the liver into bile. Required for normal sterol homeostasis. The heterodimer with ABCG8 has ATPase activity.
Gene References into Functions
ABCG5 and ABCG8 mRNA levels were significantly increased in cholesterol group and less increased in myriocin group, relative to that in normal group.PMID:28268212
The ABCG5/G8-independent pathway plays an important role in regulating biliary cholesterol secretion, and gallstone formation, which works independently of the ABCG5/G8 pathway.PMID:27014967
ABCG5/G8 mediate mass biliary cholesterol secretion but not from a reverse cholesterol transport-relevant pool.PMID:26520893
AdGRP78 reduced expression of lipogenic genes and plasma triglycerides in the db/db strain. Both G5 and G8 protein levels increased as did total biliary cholesterolPMID:26365598
The data demonstrate that Abcg5/Abcg8 deficiency reduces the uptake and secretion of both dietary triacylglycerols and cholesterol by the intestine, suggesting a novel role for the sterol transporter in the formation and secretion of chylomicrons.PMID:25676339
Sitosterolemia is caused by a genetic defect of sterolins (ABCG5/ABCG8) mapped to the STSL locus. Polymorphic variations in STSL have been linked to lipid levels and gallstone diseasePMID:24811295
The absence of an ABCG5/ABCG8 expression.PMID:25060694
Mice with deficient Abcg2 have features of inflammatory DCM and that the reversibility of myocardial T cell infiltration provides a novel model for investigating the progression of myocardial fibrosis.PMID:23129576
biliary cholesterol mass secretion under maximal bile salt-stimulated conditions is fully dependent on ABCG5/G8PMID:23401258
This study is the first to report such toxic effects of phytosterol accumulation in ABCG5/G8 knockout mice.PMID:23380580
The ability of triiodothyronine to stimulate the secretion of cholesterol into bile is largely mediated by the ABCG5/G8 complex.PMID:22829162
handling of sterols by the intestine involves both G5G8 and ACAT2 but that an additional factor (possibly Niemann-Pick C1-like 1) may be key in determining absorption efficiencyPMID:22669916
The ABCG5 ABCG8 sterol transporter opposes the development of fatty liver disease and loss of glycemic control independently of phytosterol accumulationPMID:22715101
ABCG5/G8 deficiency in mice markedly raises triglyceride levels by impairing triglyceride catabolism and by increasing liver and intestinal triglyceride secretion.PMID:21855652
NPC2 is a positive regulator of biliary cholesterol secretion via stimulation of ABCG5/G8-mediated cholesterol transport.PMID:21315718
NBD1, although not required for ATP hydrolysis, is essential for normal function of G5G8 in sterol transportPMID:21209088
Disruption in Abcg5 gene is associated with thrombocytopenia and cardiomyopathy.PMID:19846887
regulation by liver X receptors alpha and betaPMID:11901146
Although a large number of polymorphic variants were identified, strains reported to show significant differences in cholesterol absorption rates did not show significant genomic variations in Abcg5 or Abcg8.PMID:11907139
biliary cholesterol secretion by ABCG5 and ABCG8PMID:12208859
expression, dimerization, and transport of ABCG5 and ABCG8PMID:12208867
ABCG5 and ABCG8 are required for efficient secretion of cholesterol into bile and that disruption of these genes increases dramatically the responsiveness of plasma and hepatic cholesterol levels to changes in dietary cholesterol content.PMID:12444248
A role for Abcg5 and Abcg8 in regulation of biliary cholesterol secretion. Also, existence of largely independent route of cholesterol secretion.PMID:12763362
endotoxin significantly decreased mRNA levels of ABCG5 and ABCG8 in the liver, but not in the small intestinePMID:12777468
ABCG5 and ABCG8 function as obligate heterodimers to promote sterol excretion into bilePMID:14504269
Disruption of the Abcg5 gene alone is sufficient to cause hyperabsorption of dietary plant sterols and sitosterolemia in mice, whereas the ability to secrete cholesterol into bile is maintained.PMID:14699507
Abcg5 and Abcg8 in the jejunum and ileum, but not in the duodenum, were main factors in determining, in part, variations in Ch absorption efficiency.PMID:15102882
The PERA allele of Abcg5/Abcg8, on chromosome 17, is responsible for lithogenicity underlying the Lith9 cholelithiasis QTL.PMID:16151694
aging significantly enhances cholesterol absorption by suppressing expression of the jejunal and ileal sterol efflux transporter Abcg5PMID:16179600
Our data confirm that Abcg5, as part of the Abcg5/Abcg8 heterodimer, strongly controls hepatobiliary cholesterol secretion in mice.PMID:16614371
G5 and G8 are sufficient for reconstitution of sterol transfer activity in vitro and provide the first demonstration that sterols are direct transport substrates of the G5 and G8 heterodimer.PMID:16867993
distinct roles for liver and intestinal ABCG5/G8 in modulating sterol metabolism and atherosclerosis in abcg5 transgenic mice.PMID:17060690
levels of the ABCG5-ABCG8 sterol transporter in liver are regulated by the leptin axisPMID:17561514
Cholesterol secretion was highly bile salt dependent, whereas other cholesterol acceptors such as ApoAI, HDL or methyl-beta-cyclodextrin did not elicit Abcg5/g8 dependent cholesterol secretionPMID:17825296
Mutations in either ABCG5 or ABCG8 cause sitosterolemia, an inborn error of metabolism characterized by high plasma plant sterol concentrations.PMID:18156627
The cholesterol transporters Npc1l1, Abca1, Abcg5, and Abcg8 were found to be downregulated after 2, 4, and 8 wk on a cholesterol-free, high-fat diet.PMID:18356535
Both ABCG5 (G5) and ABCG8 (G8) have short but highly conserved cytoplasmic tailsPMID:18402465
Increased biliary cholesterol excretion in Atp8b1-deficient mice is independent of Abcg5/8 activity.PMID:18466903
LXR activation stimulated the fecal excretion of labeled cholesterol after an intravenous injection of HDL-[(3)H]cholesteryl oleate in G5/G8(+/+) mice, but failed to enhance fecal [(3)H]cholesterol in G5/G8(-/-) mice.PMID:18509196
Abcg5 (-/-) mice, develop sitosterolemia, a genetic disorder characterized by the accumulation of phytosterols in blood and tissuesPMID:18796403
In the liver, histone H3 in the proximal promoter of Abcg5 is hyperacetylated, whereas acetylation in the kidney and the cerebrum is minimal.PMID:19047482