MMDVNSSGRPDLYGHLRSLILPEVGRRLQDLSPDGGAHSVVSSWMPHLLSGFPEVTASPA PTWDAPPDNVSGCGEQINYGRVEKVVIGSILTLITLLTIAGNCLVVISVCFVKKLRQPSN YLIVSLALADLSVAVAVMPFVSVTDLIGGKWIFGHFFCNVFIAMDVMCCTASIMTLCVIS IDRYLGITRPLTYPVRQNGKCMAKMILSVWLLSASITLPPLFGWAQNVNDDKVCLISQDF GYTIYSTAVAFYIPMSVMLFMYYQIYKAARKSAAKHKFSGFPRVQPESVISLNGVVKLQK EVEECANLSRLLKHERKNISIFKREQKAATTLGIIVGAFTVCWLPFFLLSTARPFICGTS CSCIPLWVERTCLWLGYANSLINPFIYAFFNRDLRTTYRSLLQCQYRNINRKLSAAGMHE ALKLAERPERSEFVLQNCDHCGKKGHDT
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
This is one of the several different receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. The activity of this receptor is mediated by G proteins that stimulate adenylate cyclase.
Gene References into Functions
Downregulation of the 5-HT7 receptor in the medial prefrontal cortex (mPFC) improves neonatal administration of phencyclidine-induced attentional deficits and impulsive-like overresponding and exacerbates compulsivity. These results suggest that 5-HT7R is involved in the cognitive outcomes of schizophrenia-like symptoms similar to humans.PMID:29278697
The present study demonstrated that acute heroin administration resulted in robust disruptions in attention, impulsivity and motivation in mice.PMID:29155092
The underlying molecular machinery involves 5-HT7R-mediated activation of MMP-9, which leads to CD44 cleavage followed by Cdc42 activation.PMID:28564597
The results of this study provide evidence for the essential role of the 5HT7R in the acquisition of an allocentric strategy and in the ability to learn concomitantly both strategies.PMID:27939340
The data of this study suggest that the 5-HT7R-mediated structural reorganization during the postnatal development might have a crucial role for the development and plasticity of forebrain areas such as cortex and striatum.PMID:28122114
this study shows that 5-HT7 is expressed in the liver in vivo and in vitro in CCl4-induced damage, and that 5-HT7 receptor agonist but not the antagonist shows hepatoprotective effect against liver fibrosisPMID:28043031
5-HT7 is required for multiple actions of serotonin in the mammary glands.PMID:25664318
Activation of HTR7 promoted opening of the ion channel TRPA1, which in turn triggered itch behaviors. Acute itch triggered by serotonin or a selective serotonin reuptake inhibitor required both HTR7 and TRPA1, as did development of atopic dermatitis.PMID:26074006
Blockade of 5-HT7R Results in Increased Severity of Chronic DSS-induced Colitis.PMID:25072499
data suggest that 5-HT7R tonically modulates cognitive processes involved in consolidation performances in object recognition.PMID:23995300
These results indicate that 5-HT receptors are functionally expressed in a subpopulation of substantia gelatinosa neurons of the and activation of 5-HT receptors plays an important role in modulating orofacial nociceptive processing.PMID:24516875
The results provide evidence that lurasidone can act as a 5-HT7 receptor antagonist and provide a possible explanation for its antidepressant effect.PMID:23416039
Colitis severity was significantly lower in 5-HT7(-/-) mice.PMID:23554310
5-HT7 receptor functionally involved in the development of stress adaptation.[review]PMID:23012886
Activation of the serotonin 5-HT7 receptor promotes synaptogenesis and enhances synaptic activity in hippocampal neurons at early postnatal stages.PMID:22378867
5-HT-induced hypothermia is mediated by the 5-HT(7) receptorPMID:12529502
Binding sites consistent with mRNA distribution with highest densities found in anterior thalamic nuclei.PMID:15026130
The results indicate an important role for the 5-HT(7) receptor in contextual hippocampal-dependent learning and suggest a possible neuronal correlate for such a role is present within the CA1 region of the hippocampus.PMID:15078565
Data demonstrate distinct roles for 5-HT7R/G12 signaling pathways in neurite outgrowth and retractionPMID:16120784
The results, with selective antagonists and knockout animals, provide compelling evidence of a specific contribution of 5-HT7 receptors to spinal locomotor rhythmogenesis in vivo.PMID:16836640
The 5-HT7 receptor is of importance for behaviors affected by antidepressants; this suggests that the 5-HT7 receptor might be of relevance as a target for the treatment of obsessive-compulsive disorder.PMID:17267119
Cloning, genomic organization and functionality of 5-HT7 receptor splice variants from mouse brain are reported.PMID:18793707
5-HT(7) receptor deletion augments the effect of various SSRIs on REM sleep suppression and this effect is distinct from those mediated via 5-HT(1A) receptors.PMID:18948124
present study has shown that the 5-HT7 receptor is of importance for allocentric spatial memoryPMID:19447277
These results suggest that spinal 5-HT7 receptors are required for the production and coordination of 5-HT-induced locomotor-like activity in the neonatal mouse and are important for the coordination of voluntary locomotion in adult mice.PMID:19458153