Recombinant Mouse 5-hydroxytryptamine receptor 4 (Htr4)

Code: CSB-CF010895MO
Size:
20μg
20μg100μg
US$5398
Quantity:
Express system: in vitro E.coli expression system
Species: Mus musculus (Mouse)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
Htr4
Uniprot NO.
Alternative Names
Htr4; 5-hydroxytryptamine receptor 4; 5-HT-4; 5-HT4; Serotonin receptor 4
Species
Mus musculus (Mouse)
Source
in vitro E.coli expression system
Expression Region
1-388
Target Protein Sequence
MDKLDANVSSNEGFRSVEKVVLLTFLAVVILMAILGNLLVMVAVCRDRQLRKIKTNYFIV SLAFADLLVSVLVMPFGAIELVQDIWAYGEMFCLVRTSLDVLLTTASIFHLCCISLDRYY AICCQPLVYRNKMTPLRIALMLGGCWVLPMFISFLPIMQGWNNIGIVDVIEKRKFSHNSN STWCVFMVNKPYAITCSVVAFYIPFLLMVLAYYRIYVTAKEHAQQIQMLQRAGATSESRP QPADQHSTHRMRTETKAAKTLCVIMGCFCFCWAPFFVTNIVDPFIDYTVPEQVWTAFLWL GYINSGLNPFLYAFLNKSFRRAFLIILCCDDERYKRPPILGQTVPCSTTTINGSTHVLRD TVECGGQWESRCHLTATSPLVAAQPSDT
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
This is one of the several different receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. The activity of this receptor is mediated by G proteins that stimulate adenylate cyclase.
Gene References into Functions
  1. Prefrontal cortex 5-HT4Rs mediate hypophagia following stress. PMID:29069597
  2. Study shows that in the murine gastrointestinal tract, activation of 5-HT4 receptors with prucalopride enhances cholinergic contractions, illustrating facilitation of myenteric cholinergic neurotransmission. PMID:28332745
  3. These data suggest that correlated expression of Slc6a4 and Htr4 likely involves coregulation of genes located on different chromosomes which modulate serotonergic activity in the gut. PMID:27072889
  4. altered 5-HT4R expression may affect the development of cortical glutamatergic control of the dorsal raphe nucleus. PMID:28108396
  5. Results demonstrate that the absence of 5-HT4 receptors triggers adaptive changes that could maintain emotional states, and that the behavioural and molecular effects of fluoxetine under pathological depression appear to be critically dependent on 5-HT4 receptors. PMID:27586007
  6. HTR4's role in pulmonary function likely relates to neural innervation and control of breathing. PMID:28130264
  7. 5-HT4 receptor regulating insulin secretion and acting as a potential drug target in diabetes treatment PMID:27423314
  8. Its activation facilitates neurogenesis of injured enteric neurons.(review) PMID:26658112
  9. The findings of altered lung function and increased AHR in Htr4-null mice support a causal relationship between genetic variation in HTR4 and pulmonary function identified in human genome-wide association studies. PMID:25342126
  10. Our in vivo data using pharmacologic and genetic approaches suggest that 5-HT(4) receptors are not involved in the bronchial hyperresponsiveness to 5-HT in cigarette smoke-exposed mice PMID:24183679
  11. A highly conserved motif in the ligand-binding pocket of serotonin receptors is an important participant in ligand binding. PMID:23378516
  12. These results suggest a prominent role of 5-HT(4)R in promoting angiogenesis. PMID:22903372
  13. Endogenous 5-HT exerts a dual role in the pathogenesis of indomethacin-induced intestinal lesions: pro-ulcerogenic action via 5-HT3 receptors and anti-ulcerogenic action via 5-HT4 receptors. PMID:22699012
  14. This review presented that the 5HT4 RECEPTOR knockout mice show a correlation between 5-HT firing rate and depressive/resilience phenotypes. PMID:23089640
  15. These results show that prenatal stress and reduced 5-HT levels can alter 5-HT(4)R expression in the developing forebrain and that some 5-HT(4)R splice variants. PMID:22564922
  16. This study demonistrated that alternatively spliced multiple transcripts of 5-hydroxytryptamine receptor expression in heart. PMID:22079627
  17. Mucosal 5-HT(4) receptor activation can mediate the prokinetic and antinociceptive actions of 5-HT(4)R agonists. PMID:22226658
  18. G protein activation by serotonin type 4 receptor dimers: evidence that turning on two protomers is more efficient. PMID:21247891
  19. -HT-R splice variants and beta-ARs are differentially regulated in the embryonic telencephalon PMID:20805681
  20. adaptive changes in cholinergic systems may circumvent the absence of 5-HTR(4) to maintain long-term memory under baseline conditions PMID:20209108
  21. After bulbectomy, 5-HT(4) receptor binding was increased in the ventral hippocampus but unchanged in the dorsal hippocampus, frontal and caudal caudate putamen PMID:20060867
  22. These results suggest that during development 5-HT4-R expression undergoes a dynamic regulation and that this regulation may be important for the normal development of sensory and limbic processing. PMID:19998416
  23. 5-HT4 receptor knock-out mice have an attenuated response to stress and increased susceptibility to seizures. PMID:14724239
  24. The mechanisms underlying feeding disorders in 5-HT4 receptor knockout mice are related to a lesser efficacy of 5-HT (hypothalamus, nucleus accumbens), leptin and the cocaine-amphetamine related transcript to reduce food intake following stress. PMID:15146954
  25. SNX27 and NHERF specifically interact with the 5-HT4a receptor splice variant PMID:15466885
  26. the uncoupling and endocytosis of 5-HT4R require different GRK2 concentrations and involve distinct molecular events PMID:15919661
  27. 5-HT(4a), 5-HT(4b), 5-HT(4e), and 5-HT(4f) isoforms were found in mouse brain and gut. Enteric neuronal 5-HT(4) receptors thus are presynaptic and probably exert their prokinetic effects by strengthening excitatory neurotransmission. PMID:16037544
  28. Results describe the adaptive changes in serotonin neurons of the raphe nuclei in 5-HT(4) receptor knock-out mouse. PMID:16930432
  29. These and previous data collectively suggest that the 5-HT4 receptor may be an effective therapeutic target for AD, providing both symptomatic improvements and neuroprotection. PMID:16978609
  30. Activation of colonic myenteric neurons in the 5-HT4 receptor-mediated colonic propulsive motor response. PMID:16990446
  31. Data show that 5-HT(4) receptor stimulation in primary neurons produced a potent but transient activation of the ERK pathway that is dependent on Src tyrosine kinase but totally independent of beta-arrestin. PMID:17377064
  32. Serotoninergic 5-HT4 receptor plays an important role in mouse fetal development; in BALB/c mice there is a direct relation between its expression and the deleterious effect of maternal anti-5-HT4 receptor autoantibodies in early embryogenesis. PMID:17445258
  33. These findings provide evidence that 5-HT(4)Rs stimulation selectively increases experience-dependent structural plasticity in learning-activated hippocampal circuits. PMID:18075492
  34. Essential role of p11 in modulating signaling through 5-HT4 as well as 5-HT1B receptors supports the concept of p11 protein as a key determinant of vulnerability to depression. PMID:19211900
  35. This is the first demonstration of adult enteric neurogenesis; our results suggest that 5-HT(4) receptors are required postnatally for enteric nervous system growth and maintenance. PMID:19657021

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein. Endosome. Note=Interaction with SNX27 mediates recruitment to early endosomes, while interaction with SLC9A3R1 and EZR might target the protein to specialized subcellular regions, such as microvilli.
Protein Families
G-protein coupled receptor 1 family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products