MEILCEDNISLSSIPNSLMQLGDDSRLYPNDFNSRDANTSEASNWTIDAENRTNLSCEGY LPPTCLSILHLQEKNWSALLTTVVIILTIAGNILVIMAVSLEKKLQNATNYFLMSLAIAD MLLGFLVMPVSMLTILYGYRWPLPSKLCAVWIYLDVLFSTASIMHLCAISLDRYVAIQNP IHHSRFNSRTKAFLKIIAVWTISVGISMPIPVFGLQDDSKVFKEGSCLLADDNFVLIGSF VAFFIPLTIMVITYFLTIKSLQKEATLCVSDLSTRAKLSSFSFLPQSSLSSEKLFQRSIH REPGSYAGRRTMQSISNEQKACKVLGIVFFLFVVMWCPFFITNIMAVICKESCNENVIGA LLNVFVWIGYLSSAVNPLVYTLFNKTYRSAFSRYIQCQYKENRKPLQLILVNTIPTLAYK SSQLQVGQKKNSQEDAEPTANDCSMVTLGNQHSEEMCTDNIETVNEKVSCV
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
G-protein coupled receptor for 5-hydroxytryptamine (serotonin). Also functions as a receptor for various drugs and psychoactive substances, including mescaline, psilocybin, 1-(2,5-dimethoxy-4-iodophenyl)-2-aminopropane (DOI) and lysergic acid diethylamide (LSD). Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors. Beta-arrestin family members inhibit signaling via G proteins and mediate activation of alternative signaling pathways. Signaling activates phospholipase C and a phosphatidylinositol-calcium second messenger system that modulates the activity of phosphatidylinositol 3-kinase and promotes the release of Ca(2+) ions from intracellular stores. Affects neural activity, perception, cognition and mood. Plays a role in the regulation of behavior, including responses to anxiogenic situations and psychoactive substances. Plays a role in intestinal smooth muscle contraction, and may play a role in arterial vasoconstriction.
Gene References into Functions
A pre- and post-synaptic distribution of 5-HT2aRs was found in hippocampus, related to facilitation of object memory.PMID:27114257
these data demonstrate that sustained SERT loss of function reduces 5-HT2AR surface expression that is critical for the synergistic activation of alphaIIbbeta3 by 5-HT and ADP.PMID:27422820
heterodimerization with 5-HT2C receptors does not alter 5-HT2C Galphaq-dependent inositol phosphate signaling, 5-HT2A or 5-HT2B receptor-mediated signaling was totally blunted. This feature can be explained by a dominance of 5-HT2C on 5-HT2A and 5-HT2B receptor binding; in 5-HT2C-containing heterodimers, ligands bind and activate the 5-HT2C protomer exclusively.PMID:28258217
In the present study we have demonstrated four new principal facts concerning the role of 5-HT2A receptors in thermoregulationPMID:26621247
Allosteric signaling through an mGlu2 and 5-HT2A heteromeric receptor complex and its potential contribution to schizophrenia.PMID:26758213
Data indicate a role of presynaptic 5-hydroxytryptamine (serotonin) receptor 2A (5-HT2A receptor) located at thalamocortical synapses in the control of thalamofrontal connectivity and the associated cognitive functions.PMID:26903620
Whole-brain mapping and pharmacological screening indicated that serotonin-2A receptor (Htr2a)-expressing cells in the central amygdala (CeA) control both innate and learned freezing, but in opposing directionsPMID:26590419
Hippocampal mRNA expression of Htr2a is decreased in serotonin deficient mice after early life stress.PMID:25602134
Involvement of 5-HT2 receptors in the expression of withdrawal diarrhea in morphine-dependent micePMID:25034809
Elevated whole-blood 5HT or hyperserotonemia is a consistent finding in approximately 30% of autistic spectrum disorder individuals.PMID:24894823
Translational and ecological study involving constitutive Htr2a(-/-) knock-out mice and related SNPs in depressed patients suggests that a lower neurotransmission at the 5-HT2AR may favor the susceptibility and severity of major depressive disorderPMID:24801750
The results highlight a likely role of the 5-HT2 receptors in allergic airways disease and suggest that 5-HT2 receptor agonists may represent an effective and novel small molecule-based therapy for asthma.PMID:25416380
Results of the current study suggest aggression displayed by TLX null and heterozygous mice involves 5-HT(2A/C) receptors.PMID:23933143
the serotonin transporter has a role in regulating clearance of apoptotic cells through neuroendocrine signalingPMID:24570000
Blockade of 5-HT2A receptors strengthens antidepressant effects of escitalopram by enhancing norepinephrine transmission.PMID:23411676
These studies provide additional support for the link between 5-HT2A activation and hallucinogenesis.PMID:23376711
The cortical population of 5-HT2A receptors mediate the locomotor-suppressing effects of clozapine.PMID:22871913
Augmented contractile properties of arteries in a model of type 2 diabetes mellitus are not due to changes in 5HT(2A)/5HT(2B) receptors.PMID:23346101
Central administration of brain-derived neurotrophic factor leads to increase of 5-HT1A receptor gene expression but not 5-HT1A functional activity in mice genetically predisposed to beehavioral disorders.PMID:22531372
Three residues located at the intracellular end of transmembrane domain four are necessary for the mGlu2 receptor binding to 5TR2A.PMID:23129762
Data suggest that stimulation of 5HT2AR facilitates consolidation/extinction of fear memory and consolidation of object memory; blocking 5HT2AR impairs acquisition of fear memory extinction. Studies assume hippocampal/amygdala sites of action.PMID:22722027
These findings provide a mechanism to explain the reduced sensitivity of Egr3(-/-) mice to the locomotor suppressive effects of second generation anti-psychotics.PMID:22692564
Results suggested that 5-HT regulates epithelial proliferation and turnover. This regulation depended on neuronal rather than mucosal 5-HT. Serotonergic effects were linked to activation of 5-HT2A receptors on cholinergic submucosal neurons.PMID:22609381
The results of the present study suggest that the 5-HT2Ar could participate in the hippocampal neurotransmission by acting on different neuronal populations.PMID:22119732
Data suggest that Htr2a, serotonin, and signal transduction are important in mammary gland for induction of bone-regulating factors such as parathyroid hormone-related protein; results may apply in lactation and breast neoplasms.PMID:22318950
The results of this study suggest a significant role of 5-HT(2A)R and 5-HT(2B)R in respiratory network modulation.PMID:21789169
results indicate that 5-HT2ARs are crucial for MDMA-induced reinforcement and cue-induced reinstatement of MDMA-seeking behaviour.PMID:20942998
The 5-HT2AR-metabotropic glutamate mGluR2 receptor (mGluR2) complex is necessary for the neuropsychological responses induced by hallucinogens.PMID:21276828
Mice had high cortical 5-HT2A, but low 5-HT2C receptor densities.PMID:21340474
Both 5-HT(2A) and 5-HT(2C) receptors modulate cortical dopamine efflux, but in opposite directions.PMID:21118683
In frontal cortex of mice born to influenza virus-infected mothers, the 5-HT(2A) receptor is upregulated and the mGlu(2) receptor is downregulated, an alteration that may be involved in the behavioral changes observed.PMID:21289196
Altered serotonin transporter and/or 5-HT1A receptor functionality in hippocampus could contribute to the relatively low sociability of the BTBR mouse strain.PMID:21070242
Decreased 5-HT2A gene expression and 5-HT2A receptor functional activity was found in three investigated catalepsy prone mouse strains in comparison to catalepsy resistant AKR mice.PMID:20345894
A bifurcation of the 5-HT2A receptor signaling pathway is neurotransmitter- and beta-arrestin2-dependent.PMID:20926677
These observations point towards a direct association between amyloid-beta accumulation and changes in 5-HT2A receptor expression that is independent of upstream changes in the serotonergic systemPMID:20413853
5-HT(2A) receptor may be functionally expressed to regulate mechanisms underlying osteoblast cell proliferation, at least in part, through activation of ERK/MAPK pathways in MC3T3-E1 cells.PMID:20399747
We conclude that serotonergic connectivity was reproduced in vitro and that the serotonin neurite density is inhibited by chronic activation of the 5-HT(2) receptor.PMID:19728996
activation involving disruption of a strong ionic interaction between helices 3 and 6PMID:11801601
was found on circular and longitudinal smooth muscle cells, neurons, enterocytes, and Paneth cells.PMID:11960784
findings suggest that 5-HT2A/5-HT2C serotonin receptors may be involved in the neural control of male sexual motivation and arousalPMID:12097814
Endogenous activation of serotonin-2A receptors is required for respiratory rhythm generation in brainstem slices.PMID:12486201
Knockout of serotonin transporter alters expression of 5-HT2A and 5-HT2C receptors in various brain regions; possible relation to altered knockout mouse behaviorPMID:12614326
intracellular trafficking of 5-HT2A receptors is regulated by PSD-95PMID:12682061
5-HT(2A) receptors are strongly reduced in the frontal cortex, in the hippocampus, in the striatum and in the accumbens nucleus in socially isolated animals compared to group housed control mice.PMID:12867255
The 5-HT2A receptor expressed in NIH3T3 cells can couple to PLA2 activation though a complex signaling mechanism involving both Galphai/o-associated Gbetagamma-mediated ERK1,2 activation and Galpha12/13-coupled, Rho-mediated p38 activationPMID:12887695
The interaction of the 5-HT(2A) and the 5-HT(2C) receptor with specific sets of PDZ proteins may contribute to their different signal transduction propertiesPMID:14988405
findings indicate a specific role for cortical 5HT2AR function in the modulation of conflict anxiety, consistent with models of cortical, "top-down" influences on risk assessmentPMID:16873667
These results suggest that obesity increases hypothalamic 5-HT2A receptor gene expression, and pharmacologic inactivation of 5-HT2A receptors inhibits overfeeding and obesity in A(y) mice, but did not increase plasma adiponectin levels.PMID:17097612
Interaction between 5-HT2 receptor activity in the dorsomedial medulla and CO(2) drive may elicit a cycle of hyperventilation with airway dilation and hypoventilation with airway narrowingPMID:17537836
Detected in neurons in brain cortex. Detected in adult intestine, especially in mucosal epithelium, longitudinal and circular layers of muscularis externa and myenteric plexuses. Highly expressed in Paneth cells, and detected at lower levels in enterocyte