Recombinant Mesocricetus auratus Acyl-CoA desaturase (SCD)

Code: CSB-CF717543MRG
Size:
20μg
20μg100μg
US$5136
Quantity:
Express system: in vitro E.coli expression system
Species: Mesocricetus auratus (Golden hamster)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
SCD
Uniprot NO.
Alternative Names
SCD; FAR-17c; Stearoyl-CoA desaturase; Acyl-CoA desaturase; Delta(9-desaturase; Delta-9 desaturase; Fatty acid desaturase
Species
Mesocricetus auratus (Golden hamster)
Source
in vitro E.coli expression system
Expression Region
2-354
Target Protein Sequence
PGHLLQEEMTSSYTTTTTTITEPPSESLQKTVPLYLEEDIRPEMKEDIYDPSYQDEEGPP PKLEYVWRNIILMALLHLGALYGLVLVPSSKVYTLLWAFVYYVISIEGIGAGVHRLWSHR TYKARLPLRIFLIIANTMAFQNDVYEWARDHRAHHKFSETYADPHDSRRGFFFSHVGWLL VRKHPAVKEKGGKLDMSDLKAEKLVMFQRRYYKPAILLMCFILPTFVPWYFWGEAFVNSL CVSTFLRYTLVLNATWLVNSAAHLYGYRPYDKNIDPRENALVSLGCLGEGFHNYHHAFPY DYSASEYRWHINFTTFFIDCMAALGLAYDRKKVSKAAVLARIKRTGDGSCKSG
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Stearoyl-CoA desaturase that utilizes O(2) and electrons from reduced cytochrome b5 to introduce the first double bond into saturated fatty acyl-CoA substrates. Catalyzes the insertion of a cis double bond at the delta-9 position into fatty acyl-CoA substrates including palmitoyl-CoA and stearoyl-CoA. Gives rise to a mixture of 16:1 and 18:1 unsaturated fatty acids. Plays an important role in lipid biosynthesis. Plays an important role in regulating the expression of genes that are involved in lipogenesis and in regulating mitochondrial fatty acid oxidation. Plays an important role in body energy homeostasis. Contributes to the biosynthesis of membrane phospholipids, cholesterol esters and triglycerides.
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Protein Families
Fatty acid desaturase type 1 family
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products