Recombinant Meriones unguiculatus Beta-2 adrenergic receptor (ADRB2)

Code: CSB-CF001392MRA
Size:
20μg
20μg100μg
US$4373
Quantity:
Express system: in vitro E.coli expression system
Species: Meriones unguiculatus (Mongolian jird) (Mongolian gerbil)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
ADRB2
Uniprot NO.
Alternative Names
ADRB2; Beta-2 adrenergic receptor; Beta-2 adrenoreceptor; Beta-2 adrenoceptor; Fragment
Species
Meriones unguiculatus (Mongolian jird) (Mongolian gerbil)
Source
in vitro E.coli expression system
Expression Region
1-251
Target Protein Sequence
LACAGLVMGLAVVPFGASHILMNMWNFGNFWCEFWTSIDVLCVTASIETLCVIAVDRYIA ITAPFKYQSLLTKNKARVVILMVWIVSGLTSFLPIQMHWYRATNKEAITCYTNETCCDFF TNQAYAIASSIVSFYVPLVVMVFVYSRVFQVAKRQLQKIDKSEGRFHAQNLSQVEQDGRS GHGLRRSSKFCLKEHKALKTLGIIMGTFTLCWLPFFIVNVVHAIKENLIPKEVYILLNWL GYVNSAFNPLI
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Beta-adrenergic receptors mediate the catecholamine-induced activation of adenylate cyclase through the action of G proteins. The beta-2-adrenergic receptor binds epinephrine with an approximately 30-fold greater affinity than it does norepinephrine.
Subcellular Location
Cell membrane; Multi-pass membrane protein. Early endosome. Golgi apparatus.
Protein Families
G-protein coupled receptor 1 family, Adrenergic receptor subfamily, ADRB2 sub-subfamily
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products