Home
Product
Protein
Transmembrane Proteins
Recombinant Meleagris gallopavo Beta-1 adrenergic receptor (ADRB1)

Recombinant Meleagris gallopavo Beta-1 adrenergic receptor (ADRB1)

Code: CSB-CF001391MQV

Rate （N/A）
Review （0）

Size:

20μg100μg

US$6109

Quantity:

Express system: in vitro E.coli expression system

Species: Meleagris gallopavo (Wild turkey)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

ADRB1

Uniprot NO.

P07700

Alternative Names

ADRB1; Beta-1 adrenergic receptor; Beta-1 adrenoreceptor; Beta-1 adrenoceptor; Beta-T

Species

Meleagris gallopavo (Wild turkey)

Source

in vitro E.coli expression system

Expression Region

1-483

Target Protein Sequence

MGDGWLPPDCGPHNRSGGGGATAAPTGSRQVSAELLSQQWEAGMSLLMALVVLLIVAGNV LVIAAIGRTQRLQTLTNLFITSLACADLVMGLLVVPFGATLVVRGTWLWGSFLCECWTSL DVLCVTASIETLCVIAIDRYLAITSPFRYQSLMTRARAKVIICTVWAISALVSFLPIMMH WWRDEDPQALKCYQDPGCCDFVTNRAYAIASSIISFYIPLLIMIFVYLRVYREAKEQIRK IDRCEGRFYGSQEQPQPPPLPQHQPILGNGRASKRKTSRVMAMREHKALKTLGIIMGVFT LCWLPFFLVNIVNVFNRDLVPDWLFVFFNWLGYANSAFNPIIYCRSPDFRKAFKRLLCFP RKADRRLHAGGQPAPLPGGFISTLGSPEHSPGGTWSDCNGGTRGGSESSLEERHSKTSRS ESKMEREKNILATTRFYCTFLGNGDKAVFCTVLRIVKLFEDATCTCPHTHKLKMKWRFKQ HQA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Beta-adrenergic receptors mediate the catecholamine-induced activation of adenylate cyclase through the action of G proteins. This receptor binds epinephrine and norepinephrine with approximately equal affinity. In dorsal pons neurons, involved in the regulation of sleep/wake behaviors.

Gene References into Functions

In both sexes of Crollwitzer turkey hearts, the beta1-AR density decreased with age but significance was reached in male cardiac chambers. PMID:29253207
backbone NMR reveals allosteric signal transduction networks in the beta1-adrenergic receptor PMID:26840483
2.1 A resolution structure of cyanopindolol-bound beta1-adrenoceptor identifies an intramembrane Na+ ion that stabilises the ligand-free receptor PMID:24663151
Monoclonal anti-beta1-adrenergic receptor antibodies activate G protein signaling in the absence of beta-arrestin recruitment PMID:24253107
Although the combination of mutations severely reduced the activation ability of ADRB1, the final crystallised receptor (beta36-m23) was still a functional receptor capable of binding agonists and antagonists and activating cellular agonist responses. PMID:21547538
2.7 A resolution crystal structure of turkey beta(1)-adrenergic receptor in complex with the high-affinity antagonist cyanopindolol PMID:18594507
Molecular simulations of beta-1 AR show formation of an ionic lock, with the cytoplasmatic end of transmembrane (TM)6 helix approaching TM3 resulting in an equilibrium geometry that is stabilized by direct interaction of arginine and glutamate. PMID:19378975
The all-atom force-field energy function was used to calculate a stability score to detect stabilizing point mutations in G-protein coupled receptors. PMID:20643076
four crystal structures of the thermostabilized turkey beta(1)-adrenergic receptor bound to the full agonists carmoterol and isoprenaline and the partial agonists salbutamol and dobutamine PMID:21228877