Home
Product
Protein
Transmembrane Proteins
Recombinant Macaca mulatta (Rhesus macaque) Growth hormone receptor (GHR)

Recombinant Macaca mulatta (Rhesus macaque) Growth hormone receptor (GHR)

Code: CSB-CF009411MOW(A4)

Rate （N/A）
Review （0）

Size:

20μg100μg

US$7134

Quantity:

Express system: in vitro E.coli expression system

Species: Macaca mulatta (Rhesus macaque)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

GHR

Uniprot NO.

P79194

Species

Macaca mulatta (Rhesus macaque)

Source

in vitro E.coli expression system

Expression Region

19-638

Target Protein Sequence

FSGSEPTAAILSRASWSLQSVNPGLKTNSSKEPKFTKCRSPERETFSCHWTDAVHHGSKSLGPIQLFYTRRNIQGQTQEWKECPDYVSAGENSCYFNSSFTSVWIPYCIKLTSNGDTVDGKCFSVDEIVQPDPPIALNWTLLNVSLTGIHADILVRWEAPPNADIQKGWMVLEYELQYKEVNETKWKMMDPILSTSVPVYSLKVDKEYEVLVRSKRRNSRNYGEFSEVLYVTLPQMNQFTCEEDFYFPWLLIIIFGIFGLTVMLFVFLFSKQQRIKMLILPPVPVPKIKGINPDLLKEGKLEEVNAILAIHDSYKPEFHSDDSWVEFIELDIDEPDEKNEGSDTDRLLSSDHQKSHSNLGVKDGDSGRTSCYEPDILETDFNANNIHEGTSEVAQPQRLKGEADLLCLDQKNQNKSPYHDACPATQQPSVIQAEKNKPQPLPTDGAESTHQAAHIQLSNPSSLANIDFYAQVSDITPAGSVVLSPGQKNKAGMSQCDMHLEMVSLCQEDFIMDNAYFCEADAKKCIPVAPHIKVESHIEPSFNQEDIYITTESLTTTAGRPGTTEHIPGSEMPVPDYTSIHIVQSPQGLILNATALPLPGKEFLSSCGYVSTDQLNKIMP
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Receptor for pituitary gland growth hormone involved in regulating postnatal body growth. On ligand binding, couples to, and activates the JAK2/STAT5 pathway.; The soluble form (GHBP) acts as a reservoir of growth hormone in plasma and may be a modulator/inhibitor of GH signaling.

Subcellular Location

Cell membrane; Single-pass type I membrane protein.; [Growth hormone-binding protein]: Secreted.

Protein Families

Type I cytokine receptor family, Type 1 subfamily

Database Links

UNIGENE: Mmu.3595

KEGG: mcc:697986

STRING: 9544.ENSMMUP00000001785

Promotions