Home
Product
Protein
Transmembrane Proteins
Recombinant Macaca mulatta (Rhesus macaque) C-C chemokine receptor type 5 (CCR5)

Recombinant Macaca mulatta (Rhesus macaque) C-C chemokine receptor type 5 (CCR5)

Code: CSB-CF004844MOW

Rate （N/A）
Review （0）

Size:

20μg100μg

US$5128

Quantity:

Express system: in vitro E.coli expression system

Species: Macaca mulatta (Rhesus macaque)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

CCR5

Uniprot NO.

P61813

Species

Macaca mulatta (Rhesus macaque)

Source

in vitro E.coli expression system

Expression Region

1-352

Target Protein Sequence

MDYQVSSPTYDIDYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNILVVLILINCKR LKSMTDIYLLNLAISDLLFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFII LLTIDRYLAIVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQREGLHYTCSS HFPYSQYQFWKNFQTLKMVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTI MIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFV GEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQEISVGL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

Full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Receptor for a number of inflammatory CC-chemokines including CCL3/MIP-1-alpha, CCL4/MIP-1-beta and RANTES and subsequently transduces a signal by increasing the intracellular calcium ion level. May play a role in the control of granulocytic lineage proliferation or differentiation. Participates in T-lymphocyte migration to the infection site by acting as a chemotactic receptor.

Gene References into Functions

CCR5 inhibition may provide a cardioprotective benefit in SIV infection by preventing cardiomyocyte CCR5 signaling. PMID:24695652
A vaccine against CCR5 protects a subset of macaques upon intravaginal challenge with simian immunodeficiency virus SIVmac251. PMID:24307581
CCR5 downregulation on CD4(+) T cells by TCR activation has no measurable effect on susceptibility to SAIDS. PMID:21035160
CD4 and CD8 T cells are more vulnerable to SIV infection, indicating the the ability to express CCR5 may activate and hassten T cell death by SIV infection in vitro. PMID:20224239
Results estimate the infectivity of CCR5-tropic simian immunodeficiency virus SIV(mac251) in the gut. PMID:17507462
observed a significantly higher loss of CCR5(+) CD45RA(-) CD4(+) T cells in CD8(+) lymphocyte-depleted macaques than in controls PMID:18367534