Recombinant Macaca mulatta (Rhesus macaque) C-C chemokine receptor type 5 (CCR5)

CSB-CF004844MOW
Size:
20μg
20μg100μg
US$5128
Quantity:
Express system: in vitro E.coli expression system
Species: Macaca mulatta (Rhesus macaque)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Orders can only be placed from within the U.S.

Product Details

Target Names
CCR5
Uniprot NO.
Species
Macaca mulatta (Rhesus macaque)
Source
in vitro E.coli expression system
Expression Region
1-352
Target Protein Sequence
MDYQVSSPTYDIDYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNILVVLILINCKR LKSMTDIYLLNLAISDLLFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFII LLTIDRYLAIVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQREGLHYTCSS HFPYSQYQFWKNFQTLKMVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTI MIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFV GEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQEISVGL
Protein Length
Full length protein
Tag Info
N-terminal 10xHis-tagged
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Description

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function
Receptor for a number of inflammatory CC-chemokines including CCL3/MIP-1-alpha, CCL4/MIP-1-beta and RANTES and subsequently transduces a signal by increasing the intracellular calcium ion level. May play a role in the control of granulocytic lineage proliferation or differentiation. Participates in T-lymphocyte migration to the infection site by acting as a chemotactic receptor.
Gene References into Functions
  1. CCR5 inhibition may provide a cardioprotective benefit in SIV infection by preventing cardiomyocyte CCR5 signaling. PMID:24695652
  2. A vaccine against CCR5 protects a subset of macaques upon intravaginal challenge with simian immunodeficiency virus SIVmac251. PMID:24307581
  3. CCR5 downregulation on CD4(+) T cells by TCR activation has no measurable effect on susceptibility to SAIDS. PMID:21035160
  4. CD4 and CD8 T cells are more vulnerable to SIV infection, indicating the the ability to express CCR5 may activate and hassten T cell death by SIV infection in vitro. PMID:20224239
  5. Results estimate the infectivity of CCR5-tropic simian immunodeficiency virus SIV(mac251) in the gut. PMID:17507462
  6. observed a significantly higher loss of CCR5(+) CD45RA(-) CD4(+) T cells in CD8(+) lymphocyte-depleted macaques than in controls PMID:18367534

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Database Links

UNIGENE: Mmu.3440

KEGG: mcc:735311

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products