Recombinant Macaca mulatta Beta-2 adrenergic receptor (ADRB2)

Code: CSB-CF635694MOW
Size:
20μg
20μg100μg
US$5600
Quantity:
Express system: in vitro E.coli expression system
Species: Macaca mulatta (Rhesus macaque)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
ADRB2
Uniprot NO.
Species
Macaca mulatta (Rhesus macaque)
Source
in vitro E.coli expression system
Expression Region
1-415
Target Protein Sequence
MGQPGNGSAFLLAPNGSHAPDHDVTQERDEAWVVGMGIVMSLIVLAIVFGNVLVITAIAK FERLQTVTNYFITSLACADLVMGLAVVPFGAAHILMKMWTFGNFWCEFWTSIDVLCVTAS IETLCVIAVDRYFAITSPFKYQSLLTKNKARVIILMVWIVSGLTSFLPIQMHWYRATHQE AINCYAKETCCDFFTNQAYAIASSIVSFYVPLVIMVFVYSRVFQEAKRQLQKIDKSEGRF HAQNLSQVEQDGRTGHGLRRSSKFCLKEHKALKTLGIIMGTFTLCWLPFFIVNIVHVIQD NLIPKEVYILLNWVGYVNSGFNPLIYCRSPDFRIAFQELLCLRRSSLKACGNGYSSNSNG NTGEQSGYHLEQEKENKLLCEDLPGTEDFVGHQGTVPSDNIDSQGRSCSTNDSLL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Beta-adrenergic receptors mediate the catecholamine-induced activation of adenylate cyclase through the action of G proteins. The beta-2-adrenergic receptor binds epinephrine with an approximately 30-fold greater affinity than it does norepinephrine.
Gene References into Functions
  1. The results imply ADRB-2-mediated actions in the development of primate follicles PMID:25824473

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein. Early endosome. Golgi apparatus.
Protein Families
G-protein coupled receptor 1 family, Adrenergic receptor subfamily, ADRB2 sub-subfamily
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products