Recombinant Macaca fascicularis CX3C chemokine receptor 1 (CX3CR1)-VLPs

Recombinant Cynomolgus monkey CX3CR1 protein-VLPs

VLPs

CX3CR1

XP_015300808.2

Cancer

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Mammalian cell

1-355aa

MDPFPESVTENFEYDDSAEACYIGDIVAFGTVFLSIFYSVVFAIGLVGNLLVVFALTNSKKPKSVTDIYLLNLALSDLLFVATLPFWTHYVINEEGLQNAMCKFTTAFFFIGFFGSIFFITIISIDRYLAIVLAANSMNNRTVQHGVTISLGVWAAAILVAAPQFMFTKQKENECLGDYPEVLQEIWPVLRNVEANFLGFLLPLLIMSYCYFRIIQTLFSCKNHKKAKAIKLILLVVVVFFLFWTPYNVMIFLETLKLYDFFPSCDMRRDLRLALSVTETVAFSHCCLNPLIYAFAGEKFRRYLYHLYGKCLAVLCGRSVHVDFSPSESQRSRQGSVLSSNFTYHTSDGDASLLL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

41.6 kDa

Full Length

C-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4.

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80°C. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing.

Protein FAQs

Please contact us to get it.