Recombinant Human herpesvirus 1 Envelope glycoprotein G (gG)

In Stock
Code: CSB-CF361844HWY
Size:
20ug
20ug100ug
US$1620
Quantity:
Express system: in vitro E.coli expression system
Species: Human herpesvirus 1 (strain 17) (HHV-1) (Human herpes simplex virus 1)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Abbreviation
Recombinant Human herpesvirus 1 gG protein
Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
gG
Uniprot NO.
Alternative Names
gG; US4; Envelope glycoprotein G; gG; gG-1
Research Area
Microbiology
Species
Human herpesvirus 1 (strain 17) (HHV-1) (Human herpes simplex virus 1)
Source
in vitro E.coli expression system
Expression Region
25-238aa
Target Protein Sequence
VPTNVSSTTQPQLQTTGRPSHEAPNMTQTGTTDSPTAISLTTPDHTPPMPSIGLEEEEEEEGAGDGEHLEGGDGTRDTLPQSPGPAFPLAEDVEKDKPNRPVVPSPDPNNSPARPETSRPKTPPTIIGPLATRPTTRLTSKGRPLVPTPQHTPLFSFLTASPALDTLFVVSTVIHTLSFLCIGAMATHLCGGWSRRGRRTHPSVRYVCLPSERG
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
28.8 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Chemokine-binding protein that inhibits neutrophils' chemotaxis.
Gene References into Functions
  1. HSV-1 Us3 is a multifunctional protein that plays various roles in the viral life cycle by phosphorylating a number of viral and cellular substrates. [review] PMID:29896662
  2. It regulates the pathogenicity of herpes simplex virus type-1 PMID:28484184
  3. This study identifies the alphaherpesvirus-specific Us3 kinase as an mTORC1 activator that subverts the host cell energy-sensing program to support viral productive growth irrespective of physiological stress. PMID:28468873
  4. findings show that Us8A is a virulence factor for HSV-1 infection in mice, and the function of Us8A for viral invasion into the central nervous system from peripheral sites is regulated by Us3-mediated phosphorylation of the protein at Ser-61. PMID:27030266
  5. The difference between HSV-1 and HSV-2 Us3 kinases appeared to be due to the fact that some Us3 phosphorylation sites in HSV-1 proteins are not conserved in the corresponding HSV-2 proteins. PMID:26491159
  6. Us3 enables the nucleus to cytoplasm capsid translocation. Nevertheless, Us3 is not essential for the production of infective progeny viruses. PMID:25588052
  7. HSV-1-encoded Us3 protein interrupted TCR signaling and interleukin-2 production by inactivation of the linker for activation of T cells. PMID:25907557
  8. Ablation of this phosphorylation abolished herpes simplex virus 1 US3-mediated downregulation of CD1d expression, suggesting that phosphorylation of KIF3A is the primary mechanism of viral suppression of CD1d expression. PMID:25878107
  9. This study demonstrated that herpes simplex virus 1 protein kinase US3 significantly inhibited NF-kappaB activation via hyperphosphorylation of p65 and decreased the expression of inflammatory chemokine interleukin-8 (IL-8). PMID:24807716
  10. Sufficient dUTPase activity was required for efficient herpes simplex virus 1 replication and Us3 phosphorylation of viral dUTPase Ser-187 upregulated dUTPase activity in host cells with low cellular dUTPase activity. PMID:24760895
  11. STING is stable in cancer-derived HEp-2 or HeLa cells infected with wild-type HSV-1 but is degraded in cells infected with mutants lacking the genes encoding functional infected cell protein 0 (ICP0), ICP4, or the US3 protein kinase PMID:24449861
  12. Herpes simplex virus 1 US3 hyperphosphorylates IRF3 and inhibits beta interferon production. PMID:24049179
  13. Human herpesvirus 1 US3 is necessary and sufficient for inhibiting TLR2 signaling at or before the stage of TRAF6 ubiquitination. PMID:23478027
  14. US3 plays a significant role in down-regulation of membrane biosynthesis. PMID:22789738
  15. These results suggested that Us3 phosphorylation of UL47 Ser-77 promoted the nuclear localization of UL47 in cell cultures and played a critical role in viral replication and pathogenesis in vivo. PMID:21734045
  16. identified gB and US3 as two viral factors that together downregulate CD1d surface expression; results suggest that HSV-1 uses gB and US3 to rapidly inhibit NKT cell function in the initial antiviral response PMID:21653669
  17. The authors demonstrated that Us3 phosphorylation of glycoprotein B Thr-887 upregulated the accumulation of endocytosed of glycoprotein B from the surfaces of infected cells. PMID:21389132
  18. Us3 is an Akt surrogate with overlapping substrate specificity to activate mTORC1, stimulating translation and virus replication PMID:21123650
  19. Us3 phosphorylation of gB Thr-887 played a critical role in viral replication in vivo and in HSV-1 pathogenesis PMID:19846518
  20. This prostein accumulates in cells infected with the mutant lacking the gene encoding ICP22 mediated the phosphorylation of histone deacetylase. PMID:15956590
  21. U(S)3 and U(S)3.5 protein kinases of herpes simplex virus 1 differ with respect to their functions in blocking apoptosis and in virion maturation and egress. PMID:16571792
  22. U(S)3 protein kinase blocks histone deacetylation by a mechanism distinct from that of ICP0. PMID:16785443
  23. It was concluded that US3 was mediating the suppression of mitochondrial respiration following HHV-1 infection. PMID:16847111
  24. Us3, Us5, and Us12 viral genes each have unique inhibitory effects on the different T lymphocyte cytotoxic effects PMID:16987059
  25. US3 blocks the proteolytic cleavage that generates active caspase 3 from the transfected zymogen procaspase 3, concomitant with inhibition of apoptosis. PMID:17634220
  26. These results supported the hypothesis that Us3 phosphorylates gB and downregulates the cell surface expression of gB in HSV-1-infected cells. PMID:18945776
  27. The majority of the US3-dependent phosphorylation of gB involved the CT domain and amino acid T887, a residue present in a motif similar to that recognized by US3 in other proteins. PMID:19158241
  28. US3-mediated phosphorylation of UL31 is critical to regulate nuclear egress. PMID:19279109
  29. regulation of Us3 activity by autophosphorylation appeared to play a critical role in viral replication in vivo and in HSV-1 pathogenesis PMID:19297494
  30. regulatory and functional effects differ from Us3 protein kinase in herpes simplex virus 2 PMID:19740999

Show More

Hide All

Subcellular Location
Virion membrane; Single-pass type I membrane protein.
Protein Families
Alphaherpesvirinae glycoprotein G family
Database Links

KEGG: vg:2703404

  Email: support@cusabio.com
  Distributors Worldwide

CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products